DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP98A9

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_177595.1 Gene:CYP98A9 / 843796 AraportID:AT1G74550 Length:487 Species:Arabidopsis thaliana


Alignment Length:524 Identity:111/524 - (21%)
Similarity:223/524 - (42%) Gaps:105/524 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG-FYGLKIGKDKVVIAYT 85
            |:....||||....:||:..|:..|..:         .|: ::...|| ...:.:|....|:..:
plant    22 RRGSNIPPGPPTRFLVGNLHQLKPLWTQ---------SFS-EWSQTYGPIISVWLGSQLAVVVSS 76

  Fly    86 NDAISEMMTNEDIDGRPDGIFYRL-------RTFNSRLGVLLTD-GEMWVEQRR------FILRH 136
            :|...:::.::|         |:|       |...:...::.:| |..:|:.|:      |.|:.
plant    77 SDLAKQVLRDKD---------YQLCNRHRTARMTQNGSDLIWSDYGAHYVKMRKLCTLELFSLKS 132

  Fly   137 LKNFGFAR----SGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGR 197
            ::.|...|    |.|:..:.|:  .:..|.|..||:          :.|.|| .||.:..::.|:
plant   133 IECFRSMREMEVSSMVKSIFND--FMSDDQKPVVLR----------NYLDSV-ALNIVSRLVIGK 184

  Fly   198 RYEP-GSPEITQLLETFFELFKNIDMVGA--LFSHFPLLRFIAPNFSGYNGFVESHRSLYTFMSK 259
            .:|| ...|...::|      :...:.||  :..:...|:.::..|:....|::           
plant   185 TFEPKDGREFRSIVE------RETRLPGATKMLDYTVWLKRLSSWFTSDKAFMK----------- 232

  Fly   260 EIELHRLTYKNYDEPRDLMDSYLRAQDE--------GNDEKGMFSDQSLLAICLDMFLAGSETTN 316
                |....:|:.: |.:||.....:|:        ...||...::::::.:..:|..||::||.
plant   233 ----HMARKRNWFK-RAVMDEVYGGRDQKCFVQSLLELKEKDELTEETVMGLVWNMLTAGADTTA 292

  Fly   317 KSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIP 381
            .::.:....::..|.::|:...|:..|||..|:.. ..|..|||:.:.:..||:|:.......:|
plant   293 ITIEWAMAEMIRCPTVKEKVQDELDSVVGSGRLMS-DADIPKLPFLQCVLKEALRLHPPTPLMLP 356

  Fly   382 HRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGHLKLPEAFN--PFGFG 444
            |:|....::.||::||...|....:.:..:|.::.:|:.|.|:|:|.:......:.|.  |||.|
plant   357 HKASESVQVGGYKVPKGATVYVNVQAIARDPANWSNPDEFRPERFLVEETDVKGQDFRVLPFGSG 421

  Fly   445 RHRC-------------MGDLLGRQNLFMFT-TTVLQNFKMVAIPGQV-PEEVPLEGATAAVKPY 494
            |..|             :|.||   :.|.:| :|..::..|...||.| ..:.||:...::..|.
plant   422 RRVCPAAQLSLNMMTLALGSLL---HCFSWTSSTPREHIDMTEKPGLVCYMKAPLQALASSRLPQ 483

  Fly   495 DIML 498
            ::.|
plant   484 ELYL 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 106/498 (21%)
CYP98A9NP_177595.1 CYP98 58..475 CDD:410749 99/464 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.