DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and AT1G66540

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_176827.2 Gene:AT1G66540 / 842972 AraportID:AT1G66540 Length:386 Species:Arabidopsis thaliana


Alignment Length:336 Identity:86/336 - (25%)
Similarity:157/336 - (46%) Gaps:32/336 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 RIEMHDLTSVYVLNTLWCMLSGRRY-------EPGSPEITQLLETFFELFKNIDMVGALFSHFPL 232
            ::||:.:.|....|.:..|::|:.|       :|.:..:.||:......|.    .|....|.|:
plant    57 KVEMNSMLSNLAFNNIIRMVTGKCYYGDGAEDDPEAKRVRQLIAEAMSCFG----AGHAADHLPM 117

  Fly   233 LRFIAPNFSGYNGFVESHRS-LYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFS 296
            ||:|    :.:...|:...: |..|..:.::..|:..:.  :...::|..|..|   ..:...::
plant   118 LRWI----TDFERRVKKIAARLDEFFQRLVDEKRVAKEK--KENTMIDHLLSLQ---VSQPEYYT 173

  Fly   297 DQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPY 361
            |.::....|.:.|||::|:..:|.:....|:..||:.::...||...:||:|:.|.| |...|||
plant   174 DHTIKGTMLSLILAGTDTSAVTLEWALSSLLNNPEVLKKVRDEIDNQIGLDRLLEES-DIPNLPY 237

  Fly   362 CEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRY 426
            .:.|..|.:|::......:||.:..|.::.||::|..||::.....:..:|..:.||.||.|:|:
plant   238 LQNIVSETLRLYPAGPLLVPHISSEDCKVGGYDMPCGTMLLVNVWAIHRDPRLWDDPASFKPERF 302

  Fly   427 LFDG--HLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATA 489
            ..:|  |..|     .||.||..|.|..|.|:.:.:...:::|.|:...| |:  |||.:.....
plant   303 EKEGETHKLL-----TFGLGRRACPGSGLARRLVSLSLGSLIQCFEWERI-GE--EEVDMTEGGG 359

  Fly   490 AVKPYDIMLVA 500
            ...|..|.|||
plant   360 LTMPRAIPLVA 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 78/314 (25%)
AT1G66540NP_176827.2 p450 <4..375 CDD:386267 86/336 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.