DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP89A7

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_176673.1 Gene:CYP89A7 / 842801 AraportID:AT1G64930 Length:511 Species:Arabidopsis thaliana


Alignment Length:536 Identity:130/536 - (24%)
Similarity:221/536 - (41%) Gaps:108/536 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IWIF------CATLLAILFGGVRKPKR--FPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFAR 62
            ||:.      .:.||.:||..:|....  .||.|.::|.:|:   :..||..||.|    :.:.|
plant     3 IWLLILGSLSLSLLLNLLFFRLRDSSSLPLPPAPNFFPFLGT---LQWLRQGLGGF----NNYVR 60

  Fly    63 QYVNPYG-FYGLKI-GKDKVVIAYTNDAISEMMTNEDI--DGRPDGIFYRLRTFNSRLGVLLTDG 123
            ...:..| ...|:| .:..:.:|..:.|...::.|..:  |..|.....::.:.|.........|
plant    61 SVHHRLGPIITLRITSRPAIFVADGSLAHQALVLNGAVFADRPPAAPISKILSNNQHTITSCLYG 125

  Fly   124 EMWVEQRRFILR-----HLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDL-T 182
            ..|...||.|..     .:|::...|..:::|           |.|::.||||::..:....| .
plant   126 VTWRLLRRNITEILHPSRMKSYSHVRHWVLEI-----------LFDRLRKSGGEEPIVVFDHLHY 179

  Fly   183 SVYVLNTLWC-------------------MLSG-RRYEPGS--PEITQLL-----ETFFELFKNI 220
            :::.:..|.|                   ||.| .||...:  |:.|:|:     |.||::.:..
plant   180 AMFAVLVLMCFGDKLDEKQIKQVEYVQRQMLLGFARYSILNLCPKFTKLILRKRWEEFFQMRREQ 244

  Fly   221 DMVGALFSHFPLLRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRA- 284
            ..|        |||.|...    ...||..:.    .|.|.|         :|.::.:.||:.. 
plant   245 QDV--------LLRLIYAR----RKIVEERKK----RSSEEE---------EENKEYVQSYVDTL 284

  Fly   285 -QDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLER 348
             ..|..|||...::..::::|.:..:|||:||...|.:...:||...|||||.::||..|||.|.
plant   285 LDVELPDEKRKLNEDEIVSLCSEFLIAGSDTTATVLQWIMANLVKNQEIQERLYEEITNVVGEEA 349

  Fly   349 IPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPV 413
            .....:|..|:||.:|:.:||:|........:||....||.|.||::||...:......:..:|.
plant   350 KVVEEKDTQKMPYLKAVVMEALRRHPPGNTVLPHSVTEDTVLGGYKVPKKGTINFLVAEIGRDPK 414

  Fly   414 DFPDPESFNPDRYLFDGHLKLPEAFN----------PFGFGRHRCMGDLLGRQNLFMFTTTVLQN 468
            .:.:|.:|.|:|::.:     .||.:          |||.||..|.|..|...:|..:...:::.
plant   415 VWEEPMAFKPERFMGE-----EEAVDITGSRGIKMMPFGAGRRICPGIGLAMLHLEYYVANMVRE 474

  Fly   469 FKMVAIPGQVPEEVPL 484
            |:...:.|   .||.|
plant   475 FQWKEVEG---HEVDL 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 120/500 (24%)
CYP89A7NP_176673.1 CYP77_89 65..502 CDD:410698 112/467 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.