DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP76C5

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001319136.1 Gene:CYP76C5 / 840264 AraportID:AT1G33730 Length:368 Species:Arabidopsis thaliana


Alignment Length:345 Identity:84/345 - (24%)
Similarity:150/345 - (43%) Gaps:28/345 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 EATCLL-----QDLKDKVLKSGGKQTRIEMHDLTSVYVL----NTLWCMLSGRRYEPGSPEITQL 209
            |||..|     |:|.:.:.:|..:...:::...:.|..|    |.|:.:..|......|....::
plant    13 EATKALRMKKVQELVNFLSESSERGEAVDISRASFVTALNIISNILFSVNLGSYDSKNSSAFQEM 77

  Fly   210 LETFFELFKNIDMVGALFSHFPLLRFI-----APNFSGYNG-FVESHRSLYTFMSKEIELHRLTY 268
            :..:.|...|.|    :.:.||.:|.:     :.....|:| .::..|..|.....| ...|:..
plant    78 VIGYMESIGNPD----VSNFFPFMRLLDLQGNSKKMKEYSGKLLQVFREFYDARILE-NSSRIDE 137

  Fly   269 KNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQ 333
            |:... ||.:|:.:..|.....|..:...:.||   |||||||::|.:.::.:....|:..|:..
plant   138 KDVSS-RDFLDALIDLQQGDESEINIDEIEHLL---LDMFLAGTDTNSSTVEWAMTELLGNPKTM 198

  Fly   334 ERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKD 398
            .:...||..|:......:.|. .:||||.:|:..|..|:.....|.:|.:|..|..:.|:.:|||
plant   199 TKVQDEINRVIRQNGDVQESH-ISKLPYLQAVIKETFRLHPAAPFLLPRKAERDVDILGFHVPKD 262

  Fly   399 TMVIACFRGMLINPVDFPDPESFNPDRYL-FDGHLK-LPEAFNPFGFGRHRCMGDLLGRQNLFMF 461
            :.|:.....:..:|..:.:|..|.|:|:| .|..:| ......|||.||..|.|..|..:.:.:.
plant   263 SHVLVNVWAIGRDPNVWENPTQFEPERFLGKDIDVKGTNYELTPFGAGRRICPGLPLALKTVHLM 327

  Fly   462 TTTVLQNFKMVAIPGQVPEE 481
            ..::|..|:. .:|..|..|
plant   328 LASLLYTFEW-KLPNGVGSE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 83/342 (24%)
CYP76C5NP_001319136.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.