DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP76C6

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_174633.1 Gene:CYP76C6 / 840263 AraportID:AT1G33720 Length:511 Species:Arabidopsis thaliana


Alignment Length:519 Identity:116/519 - (22%)
Similarity:207/519 - (39%) Gaps:84/519 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IFCATLLAILFGGVRKPKR-------FPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYV 65
            |||..|..:||....:.:|       .||||...||:|:...|.:                    
plant    12 IFCFILSCLLFFTTARSRRSPCQLSKSPPGPPRLPIIGNIHLVGK-------------------- 56

  Fly    66 NP-YGF------YG----LKIGKDKVVIAYTNDAISEMMTNED--IDGRPDGIFYRLRTFNSRLG 117
            || :.|      ||    ||:|....|:..:.||:.|::...|  :.||     |......|...
plant    57 NPHHSFTDLSKTYGPVMSLKLGCLNSVVIASRDAVREVLKTHDQILSGR-----YISEATKSNNH 116

  Fly   118 VLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLL-----QDLKDKVLKSGGKQTRIE 177
            ...:.|  |:.......|.|:.....:......:  :||..|     |:|.:.:.:|..::..::
plant   117 HEFSVG--WIHPSSSRFRMLRKLSATQLFSPQCI--QATKALRMKKVQELVNFLSESCEREEAVD 177

  Fly   178 MHDLTSVYVL----NTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAP 238
            :..::.|..|    |.|:.:..|......|....:::..:.|...|.|    |.:.||.:||:..
plant   178 ISHVSFVTALNIISNILFSVNLGSYDSKNSSAFQEMVIGYQESIGNPD----LANFFPFMRFLDL 238

  Fly   239 NFSGYNGFVESHRSLYTFM----SKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQS 299
            ..:.......|.|.|..|.    ::.:|....:.:.....:|.:|..:..|.....|..:...:.
plant   239 QGNSKKMRESSGRLLQVFREFYDARIVEKSSRSVEKDVSSKDFLDVLIDLQQGDETEINIDEIEH 303

  Fly   300 LLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEA 364
            ||   ||||:||::|.:.::.:....|:..|:...:...||..|:|.....:.| |.:||||.:|
plant   304 LL---LDMFVAGTDTNSSTVEWAMAELLGNPKTMTKVQDEINHVIGQNGDFQES-DISKLPYLKA 364

  Fly   365 ITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-- 427
            :..|..|:.....|.:..:|..:..:.|:.:.||:.|:.....:..:|:.:.:|..|.|:|:|  
plant   365 VVKETFRLHPAAPFLLQRKAETNVEILGFTVLKDSQVLVNVWAIGRDPLVWENPTHFEPERFLGK 429

  Fly   428 ------FDGHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLE 485
                  .|..|      .|||.||..|.|..|..:.:.:...::|..|:.....|...|::.:|
plant   430 EIDVKGTDYEL------TPFGAGRRICPGLPLAMKTVHLMLASLLYTFEWKLPNGVGSEDLDME 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 107/485 (22%)
CYP76C6NP_174633.1 p450 11..504 CDD:299894 116/519 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.