DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP79F1

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_563996.2 Gene:CYP79F1 / 838211 AraportID:AT1G16410 Length:538 Species:Arabidopsis thaliana


Alignment Length:520 Identity:120/520 - (23%)
Similarity:206/520 - (39%) Gaps:113/520 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TLLAILFGGVRKPK----RFPPGPAWYPIVGSALQVSQLR-----CRLGMFCKVIDVFARQYVNP 67
            |||..:.....|.|    :.||||..:||:|:..::...|     .||.|.....|:....:.  
plant    26 TLLGRILSRPTKTKDRSCQLPPGPPGWPILGNLPELFMTRPRSKYFRLAMKELKTDIACFNFA-- 88

  Fly    68 YGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSR---LGVLLTDGEMWVEQ 129
             |...:.|..|::    ..:|..|  .:.|:..||.  .:.:.|....   :|: ...||.:::.
plant    89 -GIRAITINSDEI----AREAFRE--RDADLADRPQ--LFIMETIGDNYKSMGI-SPYGEQFMKM 143

  Fly   130 RRFI------LRHLKNFGFARS----GMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSV 184
            :|.|      ::.||....||:    .::..||:    :.|           :...:::.:|:.|
plant   144 KRVITTEIMSVKTLKMLEAARTIEADNLIAYVHS----MYQ-----------RSETVDVRELSRV 193

  Fly   185 YVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSH-----FPLLRFIAPNFS--- 241
            |.......||.|||:           .|...:|.:...:|....|     |..|..: |:||   
plant   194 YGYAVTMRMLFGRRH-----------VTKENVFSDDGRLGNAEKHHLEVIFNTLNCL-PSFSPAD 246

  Fly   242 -------GYNGFVESHRSLYTFMSKEIELHRLTYKNYDEP------------------RDLMDSY 281
                   |:|  |:.       ..|.:..:....::|:.|                  .|.:|::
plant   247 YVERWLRGWN--VDG-------QEKRVTENCNIVRSYNNPIIDERVQLWREEGGKAAVEDWLDTF 302

  Fly   282 LRAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGL 346
            :..:|:..  |.:.:...:.|.|::..:|..:....::.:....::..|||..:|.:|:.||||.
plant   303 ITLKDQNG--KYLVTPDEIKAQCVEFCIAAIDNPANNMEWTLGEMLKNPEILRKALKELDEVVGR 365

  Fly   347 ERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLIN 411
            :|:.:.| |...|.|.:|...|..|:.....:...|.|..||.|.||.|||.:.:..|..|:..|
plant   366 DRLVQES-DIPNLNYLKACCRETFRIHPSAHYVPSHLARQDTTLGGYFIPKGSHIHVCRPGLGRN 429

  Fly   412 PVDFPDPESFNPDRYL-FDGHLK---LPEA---FNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNF 469
            |..:.||..:.|:|:| .||..|   |.|.   |..|..||..|:|..:|...:.|.....||.|
plant   430 PKIWKDPLVYKPERHLQGDGITKEVTLVETEMRFVSFSTGRRGCIGVKVGTIMMVMLLARFLQGF 494

  Fly   470  469
            plant   495  494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 115/500 (23%)
CYP79F1NP_563996.2 PLN03018 1..538 CDD:178592 120/520 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.