DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP79F2

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_563995.2 Gene:CYP79F2 / 838210 AraportID:AT1G16400 Length:537 Species:Arabidopsis thaliana


Alignment Length:521 Identity:120/521 - (23%)
Similarity:212/521 - (40%) Gaps:101/521 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIWIFCATLLAILFGGVRKPK----RFPPG-PAWYPIVGSALQVSQLRCR-----LGMFCKVIDV 59
            :::|...|||..:|....|.|    :.||| |.| ||:|:..::...|.|     |.|.....|:
plant    18 IVFIASITLLGRIFSRPSKTKDRCRQLPPGRPGW-PILGNLPELIMTRPRSKYFHLAMKELKTDI 81

  Fly    60 FARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRP-----DGIFYRLRTFNSRLGVL 119
            ....:.   |.:.:.|..|::    ..:|..|  .:.|:..||     :.|....:|..:.    
plant    82 ACFNFA---GTHTITINSDEI----AREAFRE--RDADLADRPQLSIVESIGDNYKTMGTS---- 133

  Fly   120 LTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHN-EATCLLQDLKDKVLKSGGKQTRIEMHDLTS 183
             :.||.:::.::.|...:  .......|::.... ||..|:..:.....:|    ..:::.:|:.
plant   134 -SYGEHFMKMKKVITTEI--MSVKTLNMLEAARTIEADNLIAYIHSMYQRS----ETVDVRELSR 191

  Fly   184 VYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSH-----FPLLRFIAPNFS-- 241
            ||.......||.|||:           .|...:|.:...:|....|     |..|..: |.||  
plant   192 VYGYAVTMRMLFGRRH-----------VTKENMFSDDGRLGKAEKHHLEVIFNTLNCL-PGFSPV 244

  Fly   242 --------GYNGFVESHRSLYTFMSKEIELHRLTYKNYDEP------------------RDLMDS 280
                    |:|...|..|:       ::.::.:  ::|:.|                  .|.:|:
plant   245 DYVDRWLGGWNIDGEEERA-------KVNVNLV--RSYNNPIIDERVEIWREKGGKAAVEDWLDT 300

  Fly   281 YLRAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVG 345
            ::..:|:..:.  :.:...:.|.|::..:|..:....::.:....::..|||..:|.:|:.||||
plant   301 FITLKDQNGNY--LVTPDEIKAQCVEFCIAAIDNPANNMEWTLGEMLKNPEILRKALKELDEVVG 363

  Fly   346 LERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLI 410
            .:|:.:.| |...|.|.:|...|..|:.....:..||.|..||.|.||.|||.:.:..|..|:..
plant   364 KDRLVQES-DIRNLNYLKACCRETFRIHPSAHYVPPHVARQDTTLGGYFIPKGSHIHVCRPGLGR 427

  Fly   411 NPVDFPDPESFNPDRYL-FDGHLK---LPEA---FNPFGFGRHRCMGDLLGRQNLFMFTTTVLQN 468
            ||..:.||.::.|:|:| .||..|   |.|.   |..|..||..|:|..:|...:.|.....||.
plant   428 NPKIWKDPLAYEPERHLQGDGITKEVTLVETEMRFVSFSTGRRGCVGVKVGTIMMAMMLARFLQG 492

  Fly   469 F 469
            |
plant   493 F 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 113/494 (23%)
CYP79F2NP_563995.2 PLN03018 4..537 CDD:178592 120/521 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.