DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP78A5

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_172827.1 Gene:CYP78A5 / 837932 AraportID:AT1G13710 Length:517 Species:Arabidopsis thaliana


Alignment Length:513 Identity:120/513 - (23%)
Similarity:204/513 - (39%) Gaps:103/513 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFC-----KVIDVFARQ 63
            ||.::.....||..:.|..|.:...|||:     ||          |.:|.     :|:...|::
plant    30 TVAFLLSPGGLAWAWTGSSKSRVSIPGPS-----GS----------LSVFSGSNPHRVLAALAKR 79

  Fly    64 Y-VNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRP------DGIFYRLRTFNSRLGVLLT 121
            : .:|  .....:|..:.||:...:...|::::.....||      :.:|:|...|       ..
plant    80 FKASP--LMAFSVGFSRFVISSEPETAKEILSSSAFADRPVKESAYELLFHRAMGF-------AP 135

  Fly   122 DGEMWVEQRR------FILRHLKNFGFARSGM-MDIVHNEATCLLQDLKDKVLKSGGKQTRIEMH 179
            .||.|...||      |..|.:.:|...|.|: |.:|.          |.|.|.:......:|:.
plant   136 YGEYWRNLRRISSTHLFSPRRIASFEGVRVGIGMKMVK----------KIKSLVTSDACGEVEVK 190

  Fly   180 DLTSVYVLNTLWCMLSGRRYEPGSPE-----ITQLLETFFELFKNIDMVGALFS---HFPLLRFI 236
            .:.....||.:...:.|..|:.....     :.:|:...:||.       .:|:   ||..||:.
plant   191 KIVHFGSLNNVMTTVFGESYDFDEVNGKGCFLERLVSEGYELL-------GIFNWSDHFWFLRWF 248

  Fly   237 APNFSGYNGFVESHRSLY----TFMSKEIELHRLTYKN--YDEPRDLMDSYLRAQDEGNDEKGMF 295
                 .:.|..:..|:|.    ||:...||.|::...|  ..|..|.:|..|..|   .|||  .
plant   249 -----DFQGVRKRCRALVSEVNTFVGGIIEKHKMKKGNNLNGEENDFVDVLLGLQ---KDEK--L 303

  Fly   296 SDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLP 360
            ||..::|:..:|...|::|....:.:....:||..:||::.::||..............|..|||
plant   304 SDSDMIAVLWEMIFRGTDTVAILVEWVLARMVLHQDIQDKLYREIASATSNNIRSLSDSDIPKLP 368

  Fly   361 YCEAITLEAVRMFMLHTFGIP-----HRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPES 420
            |.:||..|.:|   ||..| |     ..|:.|..:....:|..|:.:.....:..|...:.|||:
plant   369 YLQAIVKETLR---LHPPG-PLLSWARLAIHDVHVGPNLVPAGTIAMVNMWSITHNAKIWTDPEA 429

  Fly   421 FNPDRYLFD------GHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMV 472
            |.|:|::.:      ..|:|.    |||.||..|.|..:|...:.::...::|||:.|
plant   430 FMPERFISEDVSIMGSDLRLA----PFGSGRRVCPGKAMGLATVHLWIGQLIQNFEWV 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 114/489 (23%)
CYP78A5NP_172827.1 CYP78 81..505 CDD:410699 105/447 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.