DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP71B7

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_172770.1 Gene:CYP71B7 / 837868 AraportID:AT1G13110 Length:504 Species:Arabidopsis thaliana


Alignment Length:519 Identity:117/519 - (22%)
Similarity:216/519 - (41%) Gaps:47/519 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FYTVIWIFCATLLAILFGGVRKPK-RFPPGPAWYPIVGSALQVSQL--RCRLGMFCKVIDVFARQ 63
            |..::.:|..: |:||...::..| :.||||...||:|:...::.|  .|    |..:...|...
plant     7 FLCLLPVFLVS-LSILSKRLKPSKWKLPPGPKTLPIIGNLHNLTGLPHTC----FRNLSQKFGPV 66

  Fly    64 YVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNSRLGVLLTDGEMW 126
            .:..:||.       .||:..:.:...|.:..:|::  .||:.:..|:.::|.:.......||.|
plant    67 MLLHFGFV-------PVVVISSKEGAEEALKTQDLECCSRPETVATRMISYNFKDIGFAPYGEEW 124

  Fly   127 VEQRRFILRHLKN------FGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVY 185
            ...|:.::..|.|      |.:.|....|:       |::.|.:..||......:..:..|.:..
plant   125 KALRKLVVMELLNTKKFQSFRYIREEENDL-------LIKKLTESALKKSPVNLKKTLFTLVASI 182

  Fly   186 VLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVES- 249
            |....:.:...:........:..|:..|..|...:    |....||.:.::....||.|..:.: 
plant   183 VCRLAFGVNIHKCEFVDEDNVADLVNKFEMLVAGV----AFTDFFPGVGWLVDRISGQNKTLNNV 243

  Fly   250 HRSLYTFMSKEIELHRLTYKNYDEPRDLMDSY--LRAQDEGNDEKGMFSDQSLLAICLDMFLAGS 312
            ...|.||....::.|....:...|..|::|..  |..:.|.:.|....:...|..|..|:||||.
plant   244 FSELDTFFQNVLDDHIKPGRQVSENPDVVDVMLDLMKKQEKDGESFKLTTDHLKGIISDIFLAGV 308

  Fly   313 ETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVG--LERIPEWSRDRTKLPYCEAITLEAVRMFML 375
            .|:..:|.:....|:..|.:.::...||:..:|  .:||.|  :|.:::.|.:.:..|..|:...
plant   309 NTSAVTLNWAMAELIRNPRVMKKVQDEIRTTLGDKKQRITE--QDLSQVHYFKLVVKEIFRLHPA 371

  Fly   376 HTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGHLK---LPEA 437
            ....:|...:...::.||:||..|.::.....:..:|..:.:|:.|||||:| |..:.   |...
plant   372 APLLLPRETMSHVKIQGYDIPVKTQMMINIYSIARDPKLWTNPDEFNPDRFL-DSSIDYRGLNFE 435

  Fly   438 FNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLE--GATAAVKPYDIMLV 499
            ..|||.||..|.|..||...:.:....:|..|..|...|:..:::.||  |:....|...:.||
plant   436 LLPFGSGRRICPGMTLGITTVELGLLNLLYFFDWVVPVGKNVKDINLEETGSIIISKKTTLELV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 105/469 (22%)
CYP71B7NP_172770.1 CYP71-like 62..496 CDD:410695 99/454 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.