DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP71A16

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_199073.1 Gene:CYP71A16 / 834266 AraportID:AT5G42590 Length:497 Species:Arabidopsis thaliana


Alignment Length:520 Identity:118/520 - (22%)
Similarity:203/520 - (39%) Gaps:87/520 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FYTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQ--------VSQLRCRLGMFCKVID 58
            |.|:: :|..:||.      |.....||.|...|::|:..|        :|.|..|.|....   
plant    14 FLTIL-LFFKSLLK------RPNSNLPPSPWRLPVIGNLHQLSLHPHRALSSLSARHGPLML--- 68

  Fly    59 VFARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNSRLGVLLT 121
                          |:.|:..|:|..:.|...::|...|:.  .||........:...|..|...
plant    69 --------------LRFGRVPVLIVSSADVAHDVMKTHDLKFANRPITKSAHKISNGGRDLVFAP 119

  Fly   122 DGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYV 186
            .||.|...:.....||.:....:|.... ...|.|.|::.|::..|.|    :.:.:..|.:..|
plant   120 YGEYWRNVKSLCTIHLLSNKMVQSSEKR-REEEITLLMETLEEASLSS----SSVNLSKLITNMV 179

  Fly   187 LNTLWCMLSGRRY--EPGSPEITQLLETFFELFKNIDMVG--ALFSHFPLLRFIAPNFSGYNGFV 247
            .:.:..::.|::|  |.|:.::..:.::|      :|.||  .:..:.|.|.:|. ..:|.:|.:
plant   180 SDIMGKVVLGKKYSGEEGTIDVKTITKSF------LDAVGLSPVGEYIPSLAWIG-KITGSDGKL 237

  Fly   248 ES-HRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFS-DQS-LLAICLDMFL 309
            |. .:....|:.|.::.|..|..:.:.| |.:|..|..|   .||..... |:| |..|..:|||
plant   238 EKITKQFGDFIEKVLQEHEDTTADKETP-DFVDMLLTIQ---RDETAQCQLDKSDLKVIIFEMFL 298

  Fly   310 AGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFM 374
            ..:.||:..:.:....|:..||..::...||:.|..:..... .::...:.|.:|:..|.:|:..
plant   299 GSTTTTSAVIEWAMTRLMRNPECLKKLQDEIRSVSKMNSYVS-GKEVENMNYLKAVIKEVLRLHP 362

  Fly   375 LHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDF--------PDPESFNPDRYLFDG- 430
            .....:|.....|.:|.||:|...|.||       ||....        .|.:.|.|:|: ||. 
plant   363 PLPLLVPRLLSEDVKLKGYDITAGTQVI-------INAWAIQRDTATWGSDAQEFRPERH-FDST 419

  Fly   431 ------HLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVP--LEGA 487
                  :.|    :.|||.||..|.|..||.....:....:::.|......|....:.|  :|||
plant   420 WDFVGRNFK----YIPFGAGRRLCPGIGLGSVMASVTLANLVKRFDWRVEDGPSGYDKPDLVEGA 480

  Fly   488  487
            plant   481  480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 108/483 (22%)
CYP71A16NP_199073.1 p450 4..494 CDD:299894 118/520 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.