DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP71B13

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_197896.1 Gene:CYP71B13 / 832585 AraportID:AT5G25140 Length:496 Species:Arabidopsis thaliana


Alignment Length:528 Identity:126/528 - (23%)
Similarity:221/528 - (41%) Gaps:77/528 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FYTVIWIFCATLLAILFGGVRKPKR-FPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYV 65
            :..|:::|.|::  .:....||.|: .||||...||:|:..|:.....| .||         :..
plant     5 YIIVVFVFFASI--FIAKNTRKTKKNLPPGPPRLPIIGNLHQLGSKPHR-SMF---------KLS 57

  Fly    66 NPYG-FYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLGVLLTD------G 123
            ..|| ...||:||...|:|.|.:.:.:::...|    .|.......|:.:|:...|.|      .
plant    58 EKYGPLVYLKLGKVPSVVASTPETVKDVLKTFD----KDCCSRAFLTYPARISYNLKDLAFAPYS 118

  Fly   124 EMWVEQRR------FILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLT 182
            :.|...|:      :..:.:|:|       .:|...|....::.:|...             .|.
plant   119 KYWKAVRKMTVVELYTAKRVKSF-------RNIREEEVASFVEFIKHSA-------------SLE 163

  Fly   183 SVYVLNTLWCMLSGR---RYEPG-SPEITQLLETFFELFK-NIDMVG--ALFSHFPLLRFIAPNF 240
            .:..||.....|||.   |...| :.|.::|..|:.|:.. .::::|  |...:||::..|....
plant   164 EIVNLNQTLVKLSGSVICRVGFGINLEGSKLENTYEEVIHGTMEVLGSFAASDYFPVIGGIIDRI 228

  Fly   241 SG-YNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGM----FSDQSL 300
            :| :|...:..:...:|....|:.|   .::.....|::|..|:.:   ..|.|:    |:....
plant   229 TGLHNKCEKVFKGTDSFFDHCIKHH---LEDGGSKDDIVDLLLKVE---RGEIGLGEFQFTRNHT 287

  Fly   301 LAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVV-GLERIPEWSRDRTKLPYCEA 364
            ..|.||:.|||.:|:..::.:...||:..|.:.::|..|::||: ..:.|.|  .|...|.|.:.
plant   288 KGILLDILLAGVDTSGHTITWVMTHLIKNPRVMKKAQAEVREVIKNKDNITE--EDIEGLEYLKM 350

  Fly   365 ITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD 429
            :..|.:|:..|.....|..|..|.::.||.|||.|.:......:..||..:.|||:|.|:|:: |
plant   351 VVKETLRINPLVPLLTPREASKDVKIGGYNIPKKTWIHVNIWAIHRNPNVWKDPEAFIPERFM-D 414

  Fly   430 GHLKLPEAFN----PFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATAA 490
            ..:.. :..|    |||.||..|.|..:|...:.:....:|..|......|...|:|.||.:...
plant   415 NQIDY-KGLNFELLPFGSGRRICPGIGMGMALIHLTLINLLYRFDWKLPEGMEVEDVDLEESYGL 478

  Fly   491 VKPYDIML 498
            |.|..:.|
plant   479 VCPKKVPL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 113/481 (23%)
CYP71B13NP_197896.1 p450 1..490 CDD:299894 126/528 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.