DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP71A14

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_197878.1 Gene:CYP71A14 / 832566 AraportID:AT5G24960 Length:497 Species:Arabidopsis thaliana


Alignment Length:480 Identity:116/480 - (24%)
Similarity:196/480 - (40%) Gaps:76/480 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIWIFCATLLAILFGGVRKPKRF-----------PPGPAWYPIVGSALQVSQLRCRLGMFCKVID 58
            :|.:..||:||:|.     .|:|           ||.|...|::|:..|:|....|         
plant     5 IISLCLATILALLL-----LKQFLNRTYTAKVNLPPSPWRVPVIGNLHQLSLHPHR--------- 55

  Fly    59 VFARQYVNPYG-FYGLKIGKDKVVIAYTNDAISEMMTNED--IDGRPDGIFYRLRT----FN-SR 115
             ..|...:.|| ...|..|:..|::..::|...::|...|  :..||     :|:.    || .|
plant    56 -SLRSLSHRYGPLMLLHFGRVPVLVVSSSDVAHDLMKTHDLKVANRP-----QLKVVEKIFNGGR 114

  Fly   116 LGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHD 180
            ..|....||.|.:.:...:.:|.|....:|  .:.|..|.   :.::.::|.|:....:.:.:.:
plant   115 EMVFSPYGEYWRQIKSVCIVNLLNKKKVQS--FEKVREEE---ISEMMERVEKASSDSSPLNLSE 174

  Fly   181 LTSVYVLNTLWCMLSGRRYEPGSPEITQLLETF-FELFKNIDMVGA--LFSHFPLLRFIAPNFSG 242
            |......:....:..||:|   |.|  :.:..| .::.|..::||.  :..:.|.|.:| ....|
plant   175 LLLTLTSDVTSRVSLGRKY---SKE--ESMSDFKIQMRKITELVGGFPVGEYIPCLAWI-DKLRG 233

  Fly   243 YNGFVES-HRSLYTFMSKEIELHRLTYKNYDEPR-DLMDSYLRAQDEGNDEKGMFSDQS-LLAIC 304
            .:...|. .::....|.|.::.|   ....|:|. |.:|..|..  |.::..|:...:| :..:.
plant   234 VDEKAEEVSKAFGDLMEKVLQEH---LDATDKPTLDFVDVLLSL--ERHERNGVQIRRSDIKFLI 293

  Fly   305 LDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEA 369
            |||||||:|||...|.:....|:..||..::...||:.......:.....|...:.|.:|:..|.
plant   294 LDMFLAGTETTYALLEWIMTELIRHPECMKKLQDEIRAKATKLILYISEEDVEDMKYLKAVVKEV 358

  Fly   370 VRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVI----ACFRGMLINPVDFPDPESFNPDRYL--- 427
            :|:.......:|.....|.:|.||:|...|.||    |..|..:...:   |.|.|.|:|:|   
plant   359 LRLHPPLPLLVPRELSEDIKLKGYDIAAGTQVIINAWAIQRDTMTWGI---DAEEFRPERHLDSL 420

  Fly   428 --FDGHLKLPEAFNPFGFGRHRCMG 450
              |.|   ....|.|||.||..|.|
plant   421 VDFRG---TNFEFIPFGSGRRICPG 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 108/446 (24%)
CYP71A14NP_197878.1 p450 24..496 CDD:299894 108/456 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.