DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP79B2

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001328605.1 Gene:CYP79B2 / 830154 AraportID:AT4G39950 Length:581 Species:Arabidopsis thaliana


Alignment Length:508 Identity:116/508 - (22%)
Similarity:202/508 - (39%) Gaps:89/508 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FCATLLAILFGGV-----RKPKRFPPGPAWYPIVGSALQVSQLRCR-----LGMFCKVIDVFARQ 63
            |.|..|.:|...:     :|....||||..:||:|  :..:.|:.|     |....|.::.    
plant    73 FVAITLVMLLKKLMTDPNKKKPYLPPGPTGWPIIG--MIPTMLKSRPVFRWLHSIMKQLNT---- 131

  Fly    64 YVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNED--IDGRPDGIFYRLRTFNSRLGVLLTDGEMW 126
                 ....:|:|...|:.........|::..:|  ...||.....::.:...:..|:...|:.:
plant   132 -----EIACVKLGNTHVITVTCPKIAREILKQQDALFASRPLTYAQKILSNGYKTCVITPFGDQF 191

  Fly   127 VEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLW 191
            .:.|:.::..|  ...||...:....:|....|......::|:.|.   ::...:|..|..|.:.
plant   192 KKMRKVVMTEL--VCPARHRWLHQKRSEENDHLTAWVYNMVKNSGS---VDFRFMTRHYCGNAIK 251

  Fly   192 CMLSGRR------YEPGSPEITQL--LETFFELFKNIDMVGALFS-----HFPLLRFIAPNFSGY 243
            .::.|.|      ...|.|.:..:  :|..||      .:|..|:     :.|:|..:     ..
plant   252 KLMFGTRTFSKNTAPDGGPTVEDVEHMEAMFE------ALGFTFAFCISDYLPMLTGL-----DL 305

  Fly   244 NGFVESHRSLYTFMSKEIELHRLTYKNYDEP-----------------RDLMDSYLRAQDE-GND 290
            ||..:..|.....|.|           |.:|                 .|.:|.::..:|| ||.
plant   306 NGHEKIMRESSAIMDK-----------YHDPIIDERIKMWREGKRTQIEDFLDIFISIKDEQGNP 359

  Fly   291 EKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRD 355
               :.:...:.....::.:|..:..:.::.:....:|.:|||..:|.:||..|||.||:.:.| |
plant   360 ---LLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEILRKAMEEIDRVVGKERLVQES-D 420

  Fly   356 RTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPES 420
            ..||.|.:||..||.|:..:..|.:||.|:.||.::||.|||.:.|:....|:..||..:.||..
plant   421 IPKLNYVKAILREAFRLHPVAAFNLPHVALSDTTVAGYHIPKGSQVLLSRYGLGRNPKVWADPLC 485

  Fly   421 FNPDRYLFD-GHLKLPE---AFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNF 469
            |.|:|:|.: ..:.|.|   .|..|..|:..|....||.....|....:||.|
plant   486 FKPERHLNECSEVTLTENDLRFISFSTGKRGCAAPALGTALTTMMLARLLQGF 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 111/484 (23%)
CYP79B2NP_001328605.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.