DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and FAH1

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_195345.1 Gene:FAH1 / 829779 AraportID:AT4G36220 Length:520 Species:Arabidopsis thaliana


Alignment Length:528 Identity:133/528 - (25%)
Similarity:221/528 - (41%) Gaps:84/528 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPY 68
            |.:.|..:..:.|.|...|:...:||||..:||:|:.|.:.||..|      .:...|::|   .
plant    17 TSLVIVVSLFIFISFITRRRRPPYPPGPRGWPIIGNMLMMDQLTHR------GLANLAKKY---G 72

  Fly    69 GFYGLKIGKDKVVIAYTNDAISEMMTNED--IDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRR 131
            |...|::|...:....:.:...:::..:|  ...||..|.....|::.........|..|.:.|:
plant    73 GLCHLRMGFLHMYAVSSPEVARQVLQVQDSVFSNRPATIAISYLTYDRADMAFAHYGPFWRQMRK 137

  Fly   132 FILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKS----GGKQTRI--EMHDLTSVYVLNTL 190
            ..:  :|.|...|:        |:...::|..||:::|    .||...:  ::..||.    |..
plant   138 VCV--MKVFSRKRA--------ESWASVRDEVDKMVRSVSCNVGKPINVGEQIFALTR----NIT 188

  Fly   191 WCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYN-GFVESHRSLY 254
            :....|...|.|..|..::|:.|.:||...::.    ...|...:|.|  .|.| ..|::...|.
plant   189 YRAAFGSACEKGQDEFIRILQEFSKLFGAFNVA----DFIPYFGWIDP--QGINKRLVKARNDLD 247

  Fly   255 TFMSKEIELHRLTYKNYD--EPRDLMDSYLRAQDEGNDEKGMFSDQSLL---------------- 301
            .|:...|:.|....:|.:  :..|::|:     |..:|....:|:::.|                
plant   248 GFIDDIIDEHMKKKENQNAVDDGDVVDT-----DMVDDLLAFYSEEAKLVSETADLQNSIKLTRD 307

  Fly   302 ---AICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCE 363
               ||.:|:...|:||...::.:....|:..||..:|..||:.|||||:|..|.| |..||.|.:
plant   308 NIKAIIMDVMFGGTETVASAIEWALTELLRSPEDLKRVQQELAEVVGLDRRVEES-DIEKLTYLK 371

  Fly   364 AITLEAVRMFMLHTFGIP---HRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDR 425
            ....|.:||   |. .||   |....||.:.|:.|||.:.|:.....:..:|..:.||::|.|.|
plant   372 CTLKETLRM---HP-PIPLLLHETAEDTSIDGFFIPKKSRVMINAFAIGRDPTSWTDPDTFRPSR 432

  Fly   426 YLFDGHLKLPE------AFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPL 484
            :|..|   :|:      .|.|||.||..|.|..||...|.:....:|..|......|..|.|:.:
plant   433 FLEPG---VPDFKGSNFEFIPFGSGRRSCPGMQLGLYALDLAVAHILHCFTWKLPDGMKPSELDM 494

  Fly   485 E---GATA 489
            .   |.||
plant   495 NDVFGLTA 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 123/490 (25%)
FAH1NP_195345.1 PLN02183 1..520 CDD:165828 133/528 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.