DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP82C3

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_194923.1 Gene:CYP82C3 / 829325 AraportID:AT4G31950 Length:512 Species:Arabidopsis thaliana


Alignment Length:535 Identity:129/535 - (24%)
Similarity:219/535 - (40%) Gaps:102/535 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIWIFCATLLAILFGGVRKPK--RFP-PGPAWYPIVGSALQV---SQLRCR-LGMFCKVIDVFAR 62
            ::::|.|     ||...:|||  :.| |..|| ||:|....:   .||..| ||   |:.|    
plant    13 LVFVFIA-----LFKKSKKPKYVKAPAPSGAW-PIIGHLHLLGGKEQLLYRTLG---KMAD---- 64

  Fly    63 QYVNPYGFYG----LKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLGVLLTDG 123
                   .||    |::|..:..:..:.:...:..|..|                ..|..|:|..
plant    65 -------HYGPAMSLRLGSSETFVGSSFEVAKDCFTVND----------------KALASLMTAA 106

  Fly   124 E------MWVEQRRF-ILRHLKNFGFARSGMMDIVH-NEATCLLQDLKDKVLKSGGKQ-TRIEMH 179
            .      .|:|.|:. ::..|.|   .|..|::.|. :|.:..::||....:|.||.: ..:::.
plant   107 AKHMGYVFWLEMRKIAMIELLSN---RRLQMLNNVRVSEISMGVKDLYSLWVKKGGSEPVMVDLK 168

  Fly   180 DLTSVYVLNTLWCMLSGRRY-EPGSPEITQLLETFFELFKNIDMVGALFSH----------FPLL 233
            ......:.|.:..|::|:|| ..|..|.::..|...:..|.|    |.|.|          ||.|
plant   169 SWLEDMIANMIMRMVAGKRYFGGGGAESSEHTEEARQWRKGI----AKFFHLVGIFTVSDAFPKL 229

  Fly   234 RFIAPNFSGY-NGFVESHRSLYTFMSKEIELHRLTYK---NYDEPRDLMDSYLRAQDEGNDEKGM 294
            .::  :..|: ....::.|.|...:.:.||.||...|   ......|.:|..|...::|......
plant   230 GWL--DLQGHEKEMKQTRRELDVILERWIENHRQQRKVSGTKHNDSDFVDVMLSLAEQGKLSHLQ 292

  Fly   295 F-SDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTK 358
            : ::..:...||.:.|.||||:..:|.:....|:...::.::...||...||.:|..|.| |...
plant   293 YDANTCIKTTCLALILGGSETSPSTLTWAISLLLNNKDMLKKVQDEIDIHVGRDRNVEDS-DIKN 356

  Fly   359 LPYCEAITLEAVRMFMLHTFGIPHR-AVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFN 422
            |.|.:||..|.:|::..... :.|| |:.|..::||.:|..|.:|.....:..:|..:.:|..|.
plant   357 LVYLQAIIKETLRLYPAAPL-LGHREAMEDCTVAGYNVPCGTRLIVNVWKIQRDPKVYMEPNEFR 420

  Fly   423 PDRYL------FDGHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAI------- 474
            |:|::      ||...:..|.. |||.||..|.|..|..|.|.:.....|.:|::..:       
plant   421 PERFITGEAKDFDVRGQNFELM-PFGSGRRSCPGPSLAMQMLHLGLARFLHSFEVKTVLDRPVDM 484

  Fly   475 ---PG-QVPEEVPLE 485
               || .:.:..|||
plant   485 SESPGLTITKATPLE 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 119/503 (24%)
CYP82C3NP_194923.1 p450 5..506 CDD:299894 129/535 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.