DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP82C4

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_194922.1 Gene:CYP82C4 / 829324 AraportID:AT4G31940 Length:524 Species:Arabidopsis thaliana


Alignment Length:530 Identity:131/530 - (24%)
Similarity:220/530 - (41%) Gaps:80/530 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIWIFCATLLAILFGGVRKPK--RFP-PGPAWYPIVGSALQV---SQLRCR-LGMFCKVIDVFAR 62
            ::::|.|     ||...:|||  :.| |..|| ||:|....:   .||..| ||   |:.|    
plant    13 LVFVFIA-----LFKKSKKPKYVKAPAPSGAW-PIIGHLHLLGGKEQLLYRTLG---KMAD---- 64

  Fly    63 QYVNPYGFYG----LKIGKDKVVIAYTNDAISEMMTNED--IDGRPDGIFYRLRTFNSRLGVLLT 121
                   .||    |::|.::..:..:.:...:..|..|  :..||.....:...:|..:.....
plant    65 -------HYGPAMSLQLGSNEAFVVSSFEVAKDCFTVNDKALASRPMTAAAKHMGYNFAVFGFAP 122

  Fly   122 DGEMWVEQRRF-ILRHLKNFGFARSGMMDIVH-NEATCLLQDLKDKVLKSGG-KQTRIEMHDLTS 183
            ....|.|.|:. .:..|.|   .|..|:..|. :|.|..::||.....|:|| |...:::.....
plant   123 YSAFWREMRKIATIELLSN---RRLQMLKHVRVSEITMGVKDLYSLWFKNGGTKPVMVDLKSWLE 184

  Fly   184 VYVLNTLWCMLSGRRYEPGSPEIT-----------QLLETFFELFKNIDMVGALFSHFPLLRFIA 237
            ...||.:..|::|:||..|...::           :.:..||.|.....:..|    ||.|.|. 
plant   185 DMTLNMIVRMVAGKRYFGGGGSVSSEDTEEAMQCKKAIAKFFHLIGIFTVSDA----FPTLSFF- 244

  Fly   238 PNFSGYNGFVESHRS-LYTFMSKEIELHRLTYK---NYDEPRDLMDSYLRAQDEGNDEKGMF-SD 297
             :..|:...::...| |...:.:.||.||...|   ..:...|.:|..:...::|......: ::
plant   245 -DLQGHEKEMKQTGSELDVILERWIENHRQQRKFSGTKENDSDFIDVMMSLAEQGKLSHLQYDAN 308

  Fly   298 QSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYC 362
            .|:.:.||.:.|.||:|:..:|.:....|:...|:.::|..||...||.:|..|.| |...|.|.
plant   309 TSIKSTCLALILGGSDTSASTLTWAISLLLNNKEMLKKAQDEIDIHVGRDRNVEDS-DIENLVYL 372

  Fly   363 EAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL 427
            :||..|.:|::.......|..|:.|..::||.:|..|.:|.....:..:|..:.:|..|.|:|::
plant   373 QAIIKETLRLYPAGPLLGPREAMEDCTVAGYYVPCGTRLIVNVWKIQRDPKVYMEPNEFRPERFI 437

  Fly   428 ------FDGHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAI----------PG 476
                  ||...:..|.. |||.||..|.|..|..|.|.:.....|.:|.:..:          ||
plant   438 TGEAKEFDVRGQNFELM-PFGSGRRSCPGSSLAMQVLHLGLARFLHSFDVKTVMDMPVDMSENPG 501

  Fly   477 -QVPEEVPLE 485
             .:|:..|||
plant   502 LTIPKATPLE 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 120/498 (24%)
CYP82C4NP_194922.1 p450 5..518 CDD:386267 131/530 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.