DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP71B32

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_680127.1 Gene:CYP71B32 / 824498 AraportID:AT3G53305 Length:338 Species:Arabidopsis thaliana


Alignment Length:453 Identity:83/453 - (18%)
Similarity:141/453 - (31%) Gaps:160/453 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LKIGKDKVVIAYTNDAISEMMTNEDID--GRP----DGIFYRLRTFNSRLGVLLTDGEMWVEQRR 131
            |:.|...||:..:.:|..|::...|:|  .||    :|:|.|    |.:.......||.|.|.::
plant     3 LRFGVVPVVVFSSKEAAKEVLKTHDLDTCTRPKLVANGLFSR----NFKDIGFTQYGEDWREMKK 63

  Fly   132 FILRHL------KNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTL 190
            .:...|      |:|.:.|....|:           |..|:..|...||.|::...:..:...|:
plant    64 LVGLELFSPKKHKSFRYIREEEGDL-----------LVKKISNSAQTQTLIDLRKASFSFTAGTI 117

  Fly   191 WCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVESHRSLYT 255
            :.:..|:.:                                                        
plant   118 FRLAFGQNF-------------------------------------------------------- 126

  Fly   256 FMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLG 320
                    |:..:.:.|...:|:   |.|:..|               |:   ||.::.....||
plant   127 --------HQCDFMDMDRLEELV---LEAETNG---------------CI---LALTDFLPTGLG 162

  Fly   321 FCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAV 385
            :      |...|....|       |.........|..|:.|...:..|..|:.......:|...:
plant   163 W------LVDRISGCGF-------GGSECGNNHNDLQKVEYLNMVIKETFRLHPPSPLLLPRETM 214

  Fly   386 CDTRLSGYEIPKDTMV----------IACFRGMLINPVDFPDPESFNPDRYL-----FDGH-LKL 434
            .|..:.||.|||:.::          :.|:.               ||:|:|     :.|. .||
plant   215 SDIEIQGYHIPKNALIRINTYTIGRDLKCWS---------------NPERFLNTSINYKGQDYKL 264

  Fly   435 PEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATAAVKPYDIM 497
                .|||.||..|.|..||...|.:....:|..|......|...|::.:|...|..|..:::
plant   265 ----LPFGAGRRSCPGMNLGITILELGLLNILYFFDWSFPNGMTIEDIDMEENGALNKTLELI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 79/434 (18%)
CYP71B32NP_680127.1 p450 3..311 CDD:299894 80/439 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.