DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and PAD3

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_189318.1 Gene:PAD3 / 822298 AraportID:AT3G26830 Length:490 Species:Arabidopsis thaliana


Alignment Length:480 Identity:114/480 - (23%)
Similarity:193/480 - (40%) Gaps:85/480 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LAILFGGVRKPKRF--PPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYGFYG-LKI 75
            |.::|..|.||.::  ||||...||:|:..|...|..|          ..|.....||... |:.
plant    13 LILIFLNVLKPSKYKLPPGPKKLPIIGNLHQRRTLHPR----------NRRNLAEMYGPVALLQY 67

  Fly    76 GKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRR------F 132
            |...||...:.:|..|::...|::  .||:....|...:|.:...:...|:.|...|:      |
plant    68 GFVPVVAISSKEAAEEVLKINDLECCSRPEAAGMRATFYNFKDIGMAPFGDEWSLMRKLSVVELF 132

  Fly   133 ILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSV--------YVLNT 189
            .::.|::|.:       |:..|....::.|.:...:.  ....:|....|.|        |.:|.
plant   133 SVKKLQSFKY-------IIEEENNLCVKKLSEFATRQ--SPVNLERAIFTLVGNIVCRIGYGINL 188

  Fly   190 LWCMLSGRRYEPGSPEITQLLETFFELFKNIDMV--------GALFSHF---PLLRFIAPNFSGY 243
            ..|                   .|||..:.:|:|        ..:||.|   .:.||| ...||.
plant   189 YEC-------------------DFFEADRVVDLVLKAEAVIRETVFSDFFPGRIGRFI-DCISGQ 233

  Fly   244 NGFVESHRSLY-TFMSKEIELHRLTYKNYDEPRDLM-DSYLRAQDEGNDEKGMFSDQSLLAICLD 306
            |..::::.|:. ||....:..|....:......||| |...:.:::|:..|  |:...|..:..|
plant   234 NRRLKNNFSVVDTFFQNVLNEHLKPGRESSTIVDLMIDMKKKQENDGDALK--FTTDHLKGMISD 296

  Fly   307 MFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVG--LERIPEWSRDRTKLPYCEAITLEA 369
            :|:||.........:....|:..|.:.::...||:..:|  .|||.|  .|..:|.|.:.:..|.
plant   297 IFVAGIGGVAGITLWGMTELIRNPRVMKKVQDEIRTTLGDKKERIKE--EDLNQLHYFKLVVKET 359

  Fly   370 VRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-----FD 429
            :|:.......:|.:.:...::.||::|..|.::.....|..:|..:.:.:.|||||:|     |.
plant   360 LRLHPTTPLLLPRQTMSHIKIQGYDVPAKTQILVNVYAMGRDPKLWENADEFNPDRFLDSSVDFK 424

  Fly   430 GHLKLPEAFNPFGFGRHRCMGDLLG 454
            |  |..| |.|||.||..|.|..:|
plant   425 G--KNYE-FIPFGSGRRICPGMTMG 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 109/464 (23%)
PAD3NP_189318.1 CYP71-like 59..474 CDD:410695 98/424 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.