DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP71B25

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_189258.1 Gene:CYP71B25 / 822230 AraportID:AT3G26270 Length:501 Species:Arabidopsis thaliana


Alignment Length:516 Identity:125/516 - (24%)
Similarity:232/516 - (44%) Gaps:97/516 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VRKPKR-FPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYGFYGLKIGKDKVVIAY 84
            :::.|| .|||||..||||:..|:.      ||..:.:...:::: .|  ...|::|...:|:..
plant    25 MKESKRNLPPGPAKLPIVGNLHQLQ------GMVHRCLHELSKKH-GP--VMHLQLGFVPLVLIS 80

  Fly    85 TNDAISEMMTNEDID--GRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRR------FILRHLKNFG 141
            :::|..|.:...||:  .||:....|:.:.|::...|....:.|.|.|:      |.::.:::|.
plant    81 SSEAAEEALKTHDIECCTRPNTNAARVFSRNNKNIGLGAYSDEWRELRKVAVREYFSVKKVQSFR 145

  Fly   142 FARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEP----- 201
            :.|       ..|...:::.|:|..|    ||:.:::.        .||:|:.:...:.|     
plant   146 YVR-------EEENHLMVKKLRDLAL----KQSPVDLS--------KTLFCLAASTVFRPVFGQS 191

  Fly   202 -------GSPEITQLLETFFELFKNIDMVGALFSH-FPLLRFIAPNFSGYNGFVE-SHRSLY--- 254
                   ...:|.:|:   ||..|::..   .||. ||:     |....:.|||. .|:.|:   
plant   192 FSDNKHFSEEKIEELV---FEAQKSLTF---KFSDLFPI-----PGLGWFIGFVSGQHKGLHKVF 245

  Fly   255 ----TFMSKEIELHRLTYKNYDEPR-DLMDSYL-RAQDEGNDEKGMFSDQSLLAICLDMFLAGSE 313
                .|::..|:.|:  .:|..:.| |::.|.| ...::..|:....:...|..|..|:||||.:
plant   246 IEVDNFLNHMIDDHQ--KQNQPQDRSDIVGSLLDMIHNQEQDKSFKLTIDHLKGITQDIFLAGID 308

  Fly   314 TTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGL--ERIPEWSRDRTKLPYCEAITLEAVRMFMLH 376
            |:..::.:....||..|.:.::...||:..:|:  |||.|  .|..||.|.:.:..|.:|:....
plant   309 TSAITMIWAMAELVNNPRVMKKVQDEIRSCIGIKKERIEE--EDVGKLQYLKLVIKETLRLHPAA 371

  Fly   377 TFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-----FDGHLKLPE 436
            ...:|...:.|.::.||:||:.|:::.....:..:|..:.:||.|||:|::     :.||   ..
plant   372 PLLLPRETMADIKIQGYDIPRKTLLLVSAWSLGRDPKYWKNPEEFNPERFIDCPVDYKGH---SF 433

  Fly   437 AFNPFGFGRHRCMG--------DLLGRQNLFMFTTTVLQNFKMVAI--PGQVP--EEVPLE 485
            .|.|||.||..|.|        :|.....|:.|...:.:..|.:.:  .|.|.  ::||||
plant   434 EFLPFGSGRRFCPGMASAIATIELTLLNLLYFFDWKLPEEMKDMNMEESGDVTIVKKVPLE 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 119/501 (24%)
CYP71B25NP_189258.1 p450 26..497 CDD:299894 125/515 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.