DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and C4H

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_180607.1 Gene:C4H / 817599 AraportID:AT2G30490 Length:505 Species:Arabidopsis thaliana


Alignment Length:518 Identity:124/518 - (23%)
Similarity:228/518 - (44%) Gaps:94/518 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TVIWIFCATLLAILFGGVR-KPKRFPPGPAWYPIVGSALQV-SQLRCRLGMFCKVIDVFARQYVN 66
            ::|.:|.|.:||.:...:| |..:.||||...||.|:.||| ..|..|     .::|     |..
plant     9 SLIAVFVAVILATVISKLRGKKLKLPPGPIPIPIFGNWLQVGDDLNHR-----NLVD-----YAK 63

  Fly    67 PYG-FYGLKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNSRLGVLLTDGEMWVE 128
            .:| .:.|::|:..:|:..:.|...|::..:.::  .|...:.:.:.|...:..|....||.|.:
plant    64 KFGDLFLLRMGQRNLVVVSSPDLTKEVLLTQGVEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRK 128

  Fly   129 QRRF----------ILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTR-IEMHDLT 182
            .||.          :.::.:.:.|           ||..:::|:|    |:....|: |.:....
plant   129 MRRIMTVPFFTNKVVQQNREGWEF-----------EAASVVEDVK----KNPDSATKGIVLRKRL 178

  Fly   183 SVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFS-GYNGF 246
            .:.:.|.::.::..||:|....          .||..:..:....|.      :|.:|. .|..|
plant   179 QLMMYNNMFRIMFDRRFESEDD----------PLFLRLKALNGERSR------LAQSFEYNYGDF 227

  Fly   247 VESHRSL---YTFMSKEIELHRLT-YKNY--DEPRDL--------------MDSYLRAQDEGNDE 291
            :...|..   |..:.::::..|:. :|.|  ||.:.:              :|..|.|     ::
plant   228 IPILRPFLRGYLKICQDVKDRRIALFKKYFVDERKQIASSKPTGSEGLKCAIDHILEA-----EQ 287

  Fly   292 KGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDR 356
            ||..::.::|.|..::.:|..|||..|:.:....||..||||.:...|:..|:| ..:.....|.
plant   288 KGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQSKLRNELDTVLG-PGVQVTEPDL 351

  Fly   357 TKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESF 421
            .||||.:|:..|.:|:.|.....:||..:.|.:|:||:||.::.::.....:..||..:..||.|
plant   352 HKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLAGYDIPAESKILVNAWWLANNPNSWKKPEEF 416

  Fly   422 NPDRYL-FDGHLKLPEA------FNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQ 477
            .|:|:. .:.|:   ||      :.|||.||..|.|.:|....|.:....::|||:::..|||
plant   417 RPERFFEEESHV---EANGNDFRYVPFGVGRRSCPGIILALPILGITIGRMVQNFELLPPPGQ 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 117/493 (24%)
C4HNP_180607.1 PLN02394 3..505 CDD:215221 124/518 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.