DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and AT2G12190

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_178922.1 Gene:AT2G12190 / 815688 AraportID:AT2G12190 Length:512 Species:Arabidopsis thaliana


Alignment Length:536 Identity:133/536 - (24%)
Similarity:218/536 - (40%) Gaps:107/536 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IW------IFCATLLAILFGGVRKPKR--FPPGPAWYPIVGSALQVSQ--------LRC---RLG 51
            ||      :|.:.||.:|....|....  .||.|.::|.:|:...:.|        ||.   |||
plant     3 IWLLILGSLFLSLLLNLLLFRRRDSSSLPLPPDPNFFPFLGTLQWLRQGLGGLNNYLRSVHHRLG 67

  Fly    52 MFCKV-------IDVFARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRL 109
            ....:       |.|..|...:........:..|:...|..:..||....|  |.....|..:||
plant    68 PIITLRITSRPAIFVADRSLAHQALVLNGAVFADRPPAAPISKIISSNQHN--ISSSLYGATWRL 130

  Fly   110 RTFNSRLGVLLTDG-EMWVEQRRFILRHL-KNFGFARSG----MMDIVHNEATCLL------QDL 162
            ...|....:|.... ..:...||::|..| ..||.:|..    ::|.:|.....||      ..|
plant   131 LRRNLTSEILHPSRVRSYSHARRWVLEILFDRFGKSRGEEPIVVVDHLHYAMFALLVLMCFGDKL 195

  Fly   163 KDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLL-----ETFFELFKNIDM 222
            .:|.:|......|.::...:...:|| ||            |:.|:|:     |.||::.:.   
plant   196 DEKQIKQVEYVQRRQLLGFSRFNILN-LW------------PKFTKLILRKRWEEFFQMRRE--- 244

  Fly   223 VGALFSHFPLLRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDE 287
                 .|..||    |........||..::.   .|:|.|.:::..::|      :|:.|..  |
plant   245 -----QHDVLL----PLIRARRKIVEERKNR---SSEEEEDNKVYVQSY------VDTLLEL--E 289

  Fly   288 GNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEW 352
            ..|||...::..::::|.:....|::||..:|.:...:||..||||:|.::|||.|||.|.....
plant   290 LPDEKRKLNEDEIVSLCSEFLNGGTDTTATALQWIMANLVKNPEIQKRLYEEIKSVVGEEAKEVE 354

  Fly   353 SRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPK----DTMVIACFRGMLINPV 413
            ..|..|:||.:|:.:|.:|......|.:||....||.|.||::||    :.||....|    :|:
plant   355 EEDAQKMPYLKAVVMEGLRRHPPGHFVLPHSVTEDTVLGGYKVPKKGTINFMVAEIGR----DPM 415

  Fly   414 DFPDPESFNPDRYLFDGHLKLPEAFN----------PFGFGRHRCMGDLLGRQNLFMFTTTVLQN 468
            .:.:|.:|.|:|::.:     .||.:          |||.||..|.|..|...:|..:...:::.
plant   416 VWEEPMAFKPERFMGE-----EEAVDITGSRGIKMMPFGAGRRICPGIGLAMLHLEYYVANMVRE 475

  Fly   469 FKMVAIPGQVPEEVPL 484
            |:...:.|   .||.|
plant   476 FEWKEVQG---HEVDL 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 123/500 (25%)
AT2G12190NP_178922.1 PLN00168 23..512 CDD:215086 127/516 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.