DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and cyp2u1

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001139036.1 Gene:cyp2u1 / 556280 ZFINID:ZDB-GENE-070730-1 Length:533 Species:Danio rerio


Alignment Length:490 Identity:149/490 - (30%)
Similarity:237/490 - (48%) Gaps:51/490 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNP-------------YG-FYGLKIGKD 78
            ||||..:||||:..........|..|.|....||:...||             || .:.:.:|..
Zfish    44 PPGPKPWPIVGNFGGFLVPPFILKRFVKNSKEFAKVVSNPLSPQAGLIEMSKLYGNIFSIFVGPQ 108

  Fly    79 KVVIAYTNDAISEMMTN--EDIDGRPDGIFYRLRTFNSRLGVLLTD-GEMWVEQRRFILRHLKNF 140
            .:|:....||:.:.|.|  |....||......:.|  .|.|::... |.:|...|||....|::|
Zfish   109 LMVVLTGYDAVRDAMLNHTETFSDRPHIPLVTIIT--KRKGIVFAPYGPLWRTNRRFCHSTLRSF 171

  Fly   141 GFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPE 205
            ||.|..:...:|.....:..:|:..:..:|  .:.|::..|.|..|.|.:..|..|:|:.....|
Zfish   172 GFGRMSLEPCIHEGLAIIKTELQSLIETAG--PSGIDLTPLISNAVSNIISLMSLGQRFHHEDKE 234

  Fly   206 ---ITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVESHRS---LYTFMSKEIELH 264
               :..|:....|:..|..::  |.:.||.|.::.     :..|.|..|:   :..|:.:.|..|
Zfish   235 FRNMRDLMSHGLEISVNTSIL--LVNVFPWLYYLP-----FGVFKELRRAELDITAFLKRIIARH 292

  Fly   265 RLTYKNYDEPRDLMDSY----LRAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMH 325
            |.|. :.:.|||.:|.|    |..|.||:.|:.:||:..|..|..|:|:||::||..|:.:..::
Zfish   293 RATL-DPENPRDFIDMYLVEMLAKQKEGSSEENLFSEDDLFYIIGDLFIAGTDTTTNSMLWSILY 356

  Fly   326 LVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRL 390
            :.|.|::||:..:||..|||.||:|..: |::.|||.||..:|.:||.::....|||.|...|..
Zfish   357 MSLYPDVQEKVQKEIDAVVGSERVPSLT-DKSSLPYTEATIMEVIRMTVVVPLSIPHMASETTEF 420

  Fly   391 SGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFNPFGFGRHRCMGDLLG 454
            .|:.|||.|::|.....:..:|..:.:|:.|||.|:|.| |.:...:.|.|||.||..|||:.|.
Zfish   421 RGFTIPKGTVIIPNLWSVHRDPTVWENPDDFNPSRFLDDQGKILRKDCFIPFGLGRRVCMGEQLA 485

  Fly   455 RQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATA 489
            :..||:..|:::|.|..     :.|     |||||
Zfish   486 KMELFLMFTSLMQTFTF-----RFP-----EGATA 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 143/479 (30%)
cyp2u1NP_001139036.1 p450 44..530 CDD:278495 149/490 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.