DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and cyp2d6

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001015719.1 Gene:cyp2d6 / 548436 XenbaseID:XB-GENE-855872 Length:505 Species:Xenopus tropicalis


Alignment Length:500 Identity:143/500 - (28%)
Similarity:229/500 - (45%) Gaps:54/500 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YTVIWIFCATLLAILFGGVRKP-KRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVN 66
            :|:..||...||.:.|...||| ..|||.|..:|.||:.||:.        |..:.:.| :|...
 Frog    17 FTLGIIFTLLLLLLDFMKRRKPCTDFPPSPPSWPFVGNLLQMD--------FRDLHNSF-KQLSK 72

  Fly    67 PYG-FYGLKIGKDKVVIAYTNDAISE--MMTNEDIDGRPDGIFYRLRTF--NSRLGVLLTDGEMW 126
            .|| ...|::.....|:....:.|.|  :..:||...||....|.:..|  |::..||...|:.|
 Frog    73 QYGDVMSLRVFWKPTVVLNGFEVIKEALIQKSEDTADRPPFNLYEILGFVGNNKAVVLANYGQSW 137

  Fly   127 VEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLW 191
            .:.|||.|..|::||..:..:.:.|.:||..|....:.   :.||.   .:.|.|.:..|.|.:.
 Frog   138 KDLRRFTLSTLRDFGMGKKSLEERVRDEAGYLCDAFQS---EQGGP---FDPHVLINTAVSNVIC 196

  Fly   192 CMLSGRRYEPGSPEITQLLETFFELFK-NIDMVGALFSHFP-------LLRFIAPNFSGYNGFVE 248
            .::.|.|:|....:..:||....|..| ....|..:.|..|       |.|.          |.:
 Frog   197 SIIFGERFEYDDHKFLKLLCLIEESIKAESGPVPQIISSLPWSSKVPGLARL----------FFQ 251

  Fly   249 SHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGM----FSDQSLLAICLDMFL 309
            ....:..::.:.|..|:.|:.: ...||.:|:::.   |....||:    |:||:||....|:|.
 Frog   252 PRIHMLQYLQEIINEHKQTWDS-GHTRDFIDAFML---EMKKAKGVKDSNFNDQNLLLTTADLFS 312

  Fly   310 AGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFM 374
            ||||||..:|.:..:.::|.|::|.:..:||.:|:|..|.|... |..::||..|:..|..|...
 Frog   313 AGSETTTTTLRWGLLFMLLYPDVQRKVQEEIDQVIGRTRKPTMG-DVLQMPYTNAVIHEIQRYAD 376

  Fly   375 LHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-FDGHLKLPEAF 438
            :....:||.|..||.:.|:.|||.|:::.....:|.:...:..|..|.|:.:| .||.....|||
 Frog   377 IIPLSVPHMAYRDTHIKGFFIPKGTVIMTNLSSVLKDEKVWEKPFQFYPEHFLDRDGKFVKREAF 441

  Fly   439 NPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVP 483
            ..|..||..|:|:.|.|..||:|.|::||.|..     |:|:..|
 Frog   442 MAFSAGRRVCLGEQLARMELFLFFTSLLQRFSF-----QIPDGEP 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 131/469 (28%)
cyp2d6NP_001015719.1 p450 52..501 CDD:306555 128/464 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.