DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP71A28

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001031675.2 Gene:CYP71A28 / 3770023 AraportID:AT4G20235 Length:340 Species:Arabidopsis thaliana


Alignment Length:475 Identity:93/475 - (19%)
Similarity:137/475 - (28%) Gaps:217/475 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TLLAILF-------GGVRKPKRFPPGPAWYPIVGSALQVS--------------------QLR-C 48
            |.||.||       ....||.: ||.|...|::|...|:|                    .|| |
plant    10 TFLAFLFLNPLLKRTTTTKPNQ-PPSPWRLPVIGYLHQLSLHPHRSFRSLSLRLWSAHAPSLRSC 73

  Fly    49 RLGMFCKVIDVFARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRT 111
            ....|.|.|.                          ::|...::|...|:.  .||......:..
plant    74 PYPRFSKYIS--------------------------SSDVAHDVMKTHDLKFANRPKTKAVDIII 112

  Fly   112 FNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLL-QDLKDKVLKSGGKQTR 175
            ...|.....:.||.|.:.:.....||......|| ...:...|.|.:: ..|::|||        
plant   113 NGGRDVAFSSYGEYWRQMKSLCTVHLLGRQMVRS-FEKVREEEITSVIWGSLRNKVL-------- 168

  Fly   176 IEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNF 240
                          |.|    ||.|..|....||.       |.::::||    ||:..:| |..
plant   169 --------------LLC----RREENTSDFENQLR-------KVMELLGA----FPVGDYI-PGL 203

  Fly   241 SGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSLLAICL 305
            :    :::..|.|    .:::|....|:..:.|         |...|..||              
plant   204 A----WIDKVRGL----DRKMEEVSKTFVEFLE---------RVVQEHVDE-------------- 237

  Fly   306 DMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAV 370
                .|:.||..::                               :|           |:||   
plant   238 ----GGTTTTFTAI-------------------------------DW-----------AMTL--- 253

  Fly   371 RMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGHLKLP 435
             :..::.:.| ||   ||...|                       |..|.|.|:|     ||.||
plant   254 -VVFINAWAI-HR---DTEKWG-----------------------PYAEEFKPER-----HLDLP 285

  Fly   436 -----EAFN--PFGFGRHRC 448
                 :.||  |||.||..|
plant   286 LNFQGQDFNFIPFGSGRRLC 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 86/452 (19%)
CYP71A28NP_001031675.2 p450 1..330 CDD:299894 93/475 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.