DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and AT3G32047

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001030796.1 Gene:AT3G32047 / 3769237 AraportID:AT3G32047 Length:502 Species:Arabidopsis thaliana


Alignment Length:506 Identity:120/506 - (23%)
Similarity:211/506 - (41%) Gaps:93/506 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFYTVIWIFCATLLAILFGGVRKPK-----RFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVF 60
            :.:.:|.:|  :||.:.....:|||     ..||.|...||:|          .|.:....:.  
plant    13 LIFILISLF--SLLCLFVFVFKKPKDSRGCDLPPSPPSLPIIG----------HLHLILSTLP-- 63

  Fly    61 ARQYVNPYGFYG----LKIGKDKVVIAYTNDAISEMMTNEDID----GRP---DGIFYRLRTFNS 114
            .:.:.|....||    |:.....||:..:.:...|:....|::    |.|   :.:|:...:|  
plant    64 HKSFQNISSKYGPLLLLRFFNVPVVLKSSANVAYEIFKTHDVNISSHGHPPIDECLFFGSSSF-- 126

  Fly   115 RLGVLLTDGEMWVEQRRFILRHLKNFG-FARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEM 178
               |:...|..|...::.::..|  || .|...:..:..:|......:|..|.:|....|...|.
plant   127 ---VVAPYGYYWRLMKKLMVTKL--FGPQALERLRHVREDELERFHTNLLSKEMKGETVQIAKEA 186

  Fly   179 HDLTSVYVLNTLWCMLSGRR--YEPG-SPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNF 240
            ..||:    |::..|:.||.  .|.| :..:..|:...|.|.|.|.:...|...|.:|       
plant   187 IKLTN----NSVCKMIMGRSCLEENGDAARVRGLVTETFALVKKIFLTQVLRRLFEIL------- 240

  Fly   241 SGYNGFVES----HRSLYTFMSKEIELHRLTYKNYDEP-----RDLMDSYLRA-QDEGNDEKGMF 295
             |.:.|.:.    .|....|:.|.:..|       ||.     .|:||..|.| :||..:.|  .
plant   241 -GISLFKKEILGVSRKFDEFLEKILVEH-------DEKPDFQGGDMMDVLLAAYRDENAEYK--I 295

  Fly   296 SDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLP 360
            :...:.::..::.|.|::|:.:::.:....::.:|.|.|:..:|:..|||..|:.| .:|...||
plant   296 TRNHIKSLFAELILGGTDTSAQTIEWTMAEIINKPNILEKLRKELDSVVGKTRLIE-EKDLPNLP 359

  Fly   361 YCEAITLEAVRMFMLH----TFGIPHRAVCD-TRLSGYEIPKDTMVIACFRGMLINPVDFPDPES 420
            |.:::..|.:|   ||    .||   |.|.: ..:.||.:||:|.::.....::.:|..:.||:.
plant   360 YLQSVVKEGLR---LHPPAPVFG---RKVLEGCTIKGYYVPKNTALVVNAYAVMRDPHYWEDPDE 418

  Fly   421 FNPDRYLFDGHLKLPE-----AFNPFGFGRHRCMGDLLGRQNLFMFTTTVL 466
            |.|:|:|.....|..|     .:.|||.||..|.|..||    ::|..|.:
plant   419 FKPERFLTTSSKKEEEREQELKYIPFGSGRRGCPGVNLG----YIFVGTAI 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 113/474 (24%)
AT3G32047NP_001030796.1 p450 59..496 CDD:299894 106/448 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.