DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and cyp2x10.2

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001315444.1 Gene:cyp2x10.2 / 322545 ZFINID:ZDB-GENE-060818-12 Length:496 Species:Danio rerio


Alignment Length:511 Identity:155/511 - (30%)
Similarity:242/511 - (47%) Gaps:40/511 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TVIWIFC-ATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNP 67
            |.:.:.| ...|..|...:|:||.||||||..||.|:.||::::..     .|..|.||:.|.:.
Zfish     3 TALVLLCLGAFLLYLQLRIRRPKNFPPGPAPVPIFGNLLQLNRISP-----LKDFDKFAQHYGSI 62

  Fly    68 YGFYGLKIGKDKVVIAYTNDAISEMMTNE--DIDGRPDGIFYRLRTFNSRLGVLLTD-GEMWVEQ 129
            ||.|   ||....|:......|.|.:..:  :..||.:.:.:...|...  ||::.| ||.|.|.
Zfish    63 YGIY---IGSQPAVVLTGQKMIKEALITQAAEFSGRSNNMMFSHVTGGK--GVIMADYGESWREH 122

  Fly   130 RRFILRHLKNFGFARSGMMDIVHNEA--TCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWC 192
            |||.|..|:|||..:..|...:..|.  .|||.:      :|.||.  |:...|......|.:..
Zfish   123 RRFALTTLRNFGLGKKSMEQRILEEVKHICLLLE------ESAGKS--IDPQHLYHQAASNIIAS 179

  Fly   193 MLSGRRYEPGSPEITQLLETFFELFK-NIDMVGALFSHFPLLR-FIAPNFSGYNGF--VESHRSL 253
            ::.|.|:.........|:.:..:|.| .|.....|:...|:|| |..|....:..|  :..|   
Zfish   180 VIFGSRFNYKDAYFQTLITSVEDLTKITIGPWAMLYEIAPVLRIFPLPFQKAFQYFEQITKH--- 241

  Fly   254 YTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKS 318
               :.|.:|.|: |.:...|||||:|.||...:..:|.:..|.:..::.:..|:|:||:|||:.:
Zfish   242 ---VLKVVEEHK-TSRVAGEPRDLIDCYLEEMENKSDHRTSFDESQMVTLLFDLFIAGTETTSNT 302

  Fly   319 LGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHR 383
            |....::|:....|||:..:||.||:| .|......||..:.:.:|:..|..|:..:....:.|.
Zfish   303 LRTLTLYLMTYTHIQEQCQREIDEVLG-ARDHVTYEDRNAMHFVQAVIHEGQRVADIAPLSMFHS 366

  Fly   384 AVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFNPFGFGRHR 447
            |..||:|.||.|||.|::|......|.....:..|..|||..:|.: |.....:||.||..|...
Zfish   367 AKTDTQLRGYSIPKGTIIIPYLSSSLREEGQWKFPHEFNPQNFLNEKGEFVKNDAFMPFSAGPRV 431

  Fly   448 CMGDLLGRQNLFMFTTTVLQNFKMV--AIPGQVPEEVPLEGATAAVKPYDIMLVAR 501
            |:|:.|.|..||:...|||:.|::|  ...|: |:...:.|.|.:||||.:::..|
Zfish   432 CLGENLARMELFLILVTVLRRFRLVWPKDAGE-PDFTYIYGGTQSVKPYRVIVEPR 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 139/463 (30%)
cyp2x10.2NP_001315444.1 p450 28..483 CDD:278495 146/481 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H111164
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.