DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and Cyp2c6v1

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001013926.2 Gene:Cyp2c6v1 / 293989 RGDID:619934 Length:490 Species:Rattus norvegicus


Alignment Length:510 Identity:150/510 - (29%)
Similarity:241/510 - (47%) Gaps:55/510 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQ--VSQLRCRLGMFCKVIDVFARQYVNP 67
            |:.:.|..||:|......:.| .||||...||:|:..|  |..:...|..|.||           
  Rat     8 VLTLTCLILLSIWRQSSGRGK-LPPGPIPLPIIGNIFQLNVKNITQSLTSFSKV----------- 60

  Fly    68 YG-FYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRR 131
            || .:.|..|....||.:..:|:.|.:.:...:....|.|......|..||::.:.|..|.|.||
  Rat    61 YGPVFTLYFGTKPTVILHGYEAVKEALIDHGEEFAERGSFPVAEKINKDLGIVFSHGNRWKEIRR 125

  Fly   132 FILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVL-----NTLW 191
            |.|..|:|.|..:..:.|.|..||.||:::|:    |:.|...     |.|  ::|     |.:.
  Rat   126 FTLTTLRNLGMGKRNIEDRVQEEARCLVEELR----KTNGSPC-----DPT--FILGCAPCNVIC 179

  Fly   192 CMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALF-SHFPLLRFIAPNFSGYNGFVESHRSL-- 253
            .::...|::....:...|:|...|..|.:......| |.||:|....|.         ||.:|  
  Rat   180 SIIFQNRFDYKDQDFLNLMEKLNENMKILSSPWTQFCSFFPVLIDYCPG---------SHTTLAK 235

  Fly   254 -----YTFMSKEIELHRLTYKNYDEPRDLMDSYL-RAQDEGNDEKGMFSDQSLLAICLDMFLAGS 312
                 ..::.|:|:.|:.:. :...|||.:|.|| :.:.|.::....|:.::|.....|:|.||:
  Rat   236 NVYHIRNYLLKKIKEHQESL-DVTNPRDFIDYYLIKWKQENHNPHSEFTLENLSITVTDLFGAGT 299

  Fly   313 ETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHT 377
            |||:.:|.:..:.|:..||:..:..:||..|||..|.| ..:||:::||.:|:..|..|...|..
  Rat   300 ETTSTTLRYALLLLLKCPEVTAKVQEEIDRVVGKHRSP-CMQDRSRMPYTDAMIHEVQRFIDLIP 363

  Fly   378 FGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-FDGHLKLPEAFNPF 441
            ..:||...||.:...|.|||.|.:|.....:|.:..:|||||.|:|..:| .:|..|..:.|.||
  Rat   364 TNLPHAVTCDIKFRNYLIPKGTTIITSLSSVLHDSKEFPDPEIFDPGHFLDGNGKFKKSDYFMPF 428

  Fly   442 GFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAI--PGQVPEEVPLEGATAAVKPY 494
            ..|:..|.|:.|.|..||:|.||:|||||:.::  |..: :..|:....|::.|:
  Rat   429 SAGKRMCAGEGLARMELFLFLTTILQNFKLKSVLHPKDI-DTTPVFNGFASLPPF 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 141/471 (30%)
Cyp2c6v1NP_001013926.2 CYP2C-like 61..485 CDD:410758 131/445 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.