DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and Cyp2c7

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_058854.1 Gene:Cyp2c7 / 29298 RGDID:620379 Length:490 Species:Rattus norvegicus


Alignment Length:518 Identity:134/518 - (25%)
Similarity:241/518 - (46%) Gaps:56/518 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNP 67
            :.|:.:....||::.....|: ::.||||...||:|:.||:.         .|.|.....::...
  Rat     6 FLVLTLSSLILLSLWRQSSRR-RKLPPGPTPLPIIGNFLQID---------VKNISQSLTKFSKT 60

  Fly    68 YG-FYGLKIGKDKVVIAYTNDAISEMM--TNEDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQ 129
            || .:.|.:|....||.:..:||.|.:  ..|...||  |.:..........|::.::|..|.|.
  Rat    61 YGPVFTLYLGSQPTVILHGYEAIKEALIDNGEKFSGR--GSYPMNENVTKGFGIVFSNGNRWKEM 123

  Fly   130 RRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWC-- 192
            |||.:.:.:|.|..:..:.|.|..||.||:::|:    |:.|......:       :||...|  
  Rat   124 RRFTIMNFRNLGIGKRNIEDRVQEEAQCLVEELR----KTKGSPCDPSL-------ILNCAPCNV 177

  Fly   193 ---MLSGRRYEPGSPEITQLLETFFELFKNI--------DMVGALFSHFPLLRFIAPNFSGYNGF 246
               :.....::....|:...:|...|..|.:        :...:|..:||         ..::..
  Rat   178 ICSITFQNHFDYKDKEMLTFMEKVNENLKIMSSPWMQVCNSFPSLIDYFP---------GTHHKI 233

  Fly   247 VESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGND-EKGMFSDQSLLAICLDMFLA 310
            .::...:.:::.|:||.|:.:. :...|||.:|.||..|.:.|: |:..:|.::|....:|:..|
  Rat   234 AKNINYMKSYLLKKIEEHQESL-DVTNPRDFVDYYLIKQKQANNIEQSEYSHENLTCSIMDLIGA 297

  Fly   311 GSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFML 375
            |:||.:.:|.:..:.|:..|.:..:..:||..|:|..|.| ..:||..:||.:|:..|..|....
  Rat   298 GTETMSTTLRYALLLLMKYPHVTAKVQEEIDRVIGRHRSP-CMQDRKHMPYTDAMIHEVQRFINF 361

  Fly   376 HTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFN 439
            ....:||...||.:...|.|||.|.|:.....:|.:..:||:||.|:|..:|.: |:.|..:.|.
  Rat   362 VPTNLPHAVTCDIKFRNYLIPKGTKVLTSLTSVLHDSKEFPNPEMFDPGHFLDENGNFKKSDYFL 426

  Fly   440 PFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAI--PGQVPEEVPLEGATAAVKP-YDIMLV 499
            ||..|:..|:|:.|.|..||:|.||:||||.:.::  |..: :.:|:....|::.| |.:..:
  Rat   427 PFSAGKRACVGEGLARMQLFLFLTTILQNFNLKSLVHPKDI-DTMPVLNGFASLPPTYQLCFI 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 126/471 (27%)
Cyp2c7NP_058854.1 p450 30..487 CDD:278495 130/490 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.