DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and Cyp2g1

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_036919.1 Gene:Cyp2g1 / 25251 RGDID:2477 Length:494 Species:Rattus norvegicus


Alignment Length:515 Identity:139/515 - (26%)
Similarity:244/515 - (47%) Gaps:43/515 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YTVIWIFCATLLAILFGGVRKPK--RFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYV 65
            :::....|.:.|.||....|..:  :.||||...|.:|:.||| ::......|.|:    .::|.
  Rat     7 FSIFMTLCLSCLLILIAWKRTSRGGKLPPGPTPIPFLGNLLQV-RIDATFQSFLKL----QKKYG 66

  Fly    66 NPYGFYGLKIGKDKVVIAYTNDAISEMMTN--EDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVE 128
            :.:..|   .|...|||...::|:.|.:.:  :|..||  |....|.......|:.|::||.|..
  Rat    67 SVFTVY---FGPRPVVILCGHEAVKEALVDQADDFSGR--GEMPTLEKNFQGYGLALSNGERWKI 126

  Fly   129 QRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCM 193
            .|||.|..|:|||..:..:.:.:..||..||::| .||     |...|:.....|..|.|.:..:
  Rat   127 LRRFSLTVLRNFGMGKRSIEERIQEEAGYLLEEL-HKV-----KGAPIDPTFYLSRTVSNVICSV 185

  Fly   194 LSGRRYEPGSPEITQLLETFFELFKNI--------DMVGALFSHFPLLRFIAPNFSGYNGFVESH 250
            :.|:|::........|::...|.|..:        ||...:..:||         ..:|......
  Rat   186 VFGKRFDYEDQRFRSLMKMINESFVEMSMPWAQLYDMYWGVIQYFP---------GRHNRLYNLI 241

  Fly   251 RSLYTFMSKEIELHRLTYKNYDEPRDLMDSYL-RAQDEGNDEKGMFSDQSLLAICLDMFLAGSET 314
            ..|..|::..::::..:: :...|||.:|.:| :...:.:|....|:.::|:...|::|.||:||
  Rat   242 EELKDFIASRVKINEASF-DPSNPRDFIDCFLIKMYQDKSDPHSEFNLKNLVLTTLNLFFAGTET 305

  Fly   315 TNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFG 379
            .:.:|.:.|:.|:..||::.:..:||.:|:|..|.|... ||.|:||.:|:..|..|:..:...|
  Rat   306 VSSTLRYGFLLLMKYPEVEAKIHEEINQVIGTHRTPRVD-DRAKMPYTDAVIHEIQRLTDIVPLG 369

  Fly   380 IPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFNPFGF 443
            :||..:.||...||.:||.|.|......:|.:|..|..||:|.|..:|.: |..|..:||..|..
  Rat   370 VPHNVIRDTHFRGYFLPKGTDVYPLIGSVLKDPKYFRYPEAFYPQHFLDEQGRFKKNDAFVAFSS 434

  Fly   444 GRHRCMGDLLGRQNLFMFTTTVLQNFKMVAI--PGQVPEEVPLEGATAAVKPYDIMLVAR 501
            |:..|:|:.|.|..||::.|::||.|.:.::  |..:.....:.|.......|::..:||
  Rat   435 GKRICVGEALARMELFLYFTSILQRFSLRSLVPPADIDIAHKISGFGNIPPTYELCFMAR 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 130/465 (28%)
Cyp2g1NP_036919.1 p450 34..491 CDD:278495 132/483 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.