DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and cyp-33E3

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_501471.1 Gene:cyp-33E3 / 185652 WormBaseID:WBGene00018333 Length:236 Species:Caenorhabditis elegans


Alignment Length:211 Identity:51/211 - (24%)
Similarity:99/211 - (46%) Gaps:49/211 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFYTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYV 65
            :|:.:.|               |.:..|||||..|.||:.|.::: :.:.|.  |:.|...:||.
 Worm    14 LFHFIYW---------------KRRNLPPGPAPLPFVGNLLMLTE-KVKPGY--KLWDSLTQQYG 60

  Fly    66 NPYGFY--GLK---IGKDKVVIAY-TNDAISEMMTNEDIDGRPDGIFYRLRTFNSR--LGVLLTD 122
            :.:.|:  ||.   :...|::..| ..|..|.:       |||:   :.|.|...:  .|::...
 Worm    61 SVFTFWMAGLPMVFVTDWKLIKQYFIKDGGSYV-------GRPE---FPLNTEVKKGPYGIIDAH 115

  Fly   123 GEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDL--TSV- 184
            |..|::||||.|..|::||..::.|.:.:..|.|.:::.|:..:       ..::|.::  ||: 
 Worm   116 GNRWIQQRRFALHVLRDFGLGKNIMEEKILTEVTVMIERLRKTI-------ACVDMQNVFDTSIG 173

  Fly   185 YVLNTLWCMLSGRRYE 200
            .::|:|   :.|.|::
 Worm   174 SIINSL---IFGYRFD 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 48/184 (26%)
cyp-33E3NP_501471.1 p450 26..>186 CDD:299894 48/182 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.