DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and Cyp2ac1

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_017452383.2 Gene:Cyp2ac1 / 108351992 RGDID:1564244 Length:499 Species:Rattus norvegicus


Alignment Length:537 Identity:150/537 - (27%)
Similarity:246/537 - (45%) Gaps:84/537 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FYTVIWIFCATLLAIL----FGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFAR 62
            |..::.:....|:.||    |......::.||||..:|::|: |.:..|:              |
  Rat     6 FSAILALLGLILILILNIKDFMAKASKRQCPPGPKPWPVIGN-LHILNLK--------------R 55

  Fly    63 QY------VNPYG-FYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDG------IFYRLRTFNS 114
            .|      ...|| .|.:::|..|||:....:.:.:.:.|.   |...|      ||.||  |:.
  Rat    56 PYQTMLELSKKYGPIYSIQMGPRKVVVLSGYETVKDALVNY---GNQFGERSQVPIFERL--FDG 115

  Fly   115 RLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMH 179
            : |:....||.|...|||.|..|::||..:..:.|.:..|...|:|..:..      |....|:.
  Rat   116 K-GIAFAHGETWKTMRRFSLSTLRDFGMGKRTIEDTIVVECQHLIQSFESH------KGKPFEIK 173

  Fly   180 DLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVG----ALFSHFPLLRFIAPNF 240
            .:.:..|.|.:..||.|:|::...|:..:||....|   ||.::|    .||:.||:|.|:    
  Rat   174 RVLNASVANVIVSMLLGKRFDYEDPQFLRLLTLIGE---NIKLIGNPSIVLFNIFPILGFL---- 231

  Fly   241 SGYNGFVESHR-------SLYTFMSKEI--ELHRLTYKNYDEPRDLMDSYL-RAQDEGNDEKGMF 295
                  :.||:       .|::|:.:..  ..|.|. ||  :||..:|::| :.|:|.|.....|
  Rat   232 ------LRSHKKVLRNRDELFSFIRRTFLEHCHNLD-KN--DPRSFIDAFLVKQQEENNKSADYF 287

  Fly   296 SDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVG--LERIPEWSRDRTK 358
            ::::|||:..::|.||:|||..:|.:..:.::..||:|::...||.:|||  ..||    ..||:
  Rat   288 NEENLLALVSNLFTAGTETTAATLRWGIILMMRYPEVQKKVHDEIHKVVGSAQPRI----EHRTQ 348

  Fly   359 LPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNP 423
            :||.:|:..|..|:..:....:||....|.....|.|||.|.||.....:|.:...:..|::|||
  Rat   349 MPYTDAVIHEIQRVANILPTSLPHETSTDVVFKNYYIPKGTEVITLLTSVLRDQTQWETPDAFNP 413

  Fly   424 DRYLFD-GHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLE-- 485
            ..:|.. |.....|||.||..||..|.|:.|.:..||:|.|:::|.|.....||....::.|.  
  Rat   414 AHFLSSKGRFVKKEAFMPFSVGRRMCAGEPLAKMELFLFFTSLMQKFTFQPPPGVSYLDLDLTPD 478

  Fly   486 -GATAAVKPYDIMLVAR 501
             |.|....|:.|..:.|
  Rat   479 IGFTIQPLPHKICALLR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 139/481 (29%)
Cyp2ac1XP_017452383.2 cytochrome_P450 67..490 CDD:425388 133/454 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.