DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NTRK3 and Ror

DIOPT Version :9

Sequence 1:XP_016877743.1 Gene:NTRK3 / 4916 HGNCID:8033 Length:850 Species:Homo sapiens
Sequence 2:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster


Alignment Length:630 Identity:198/630 - (31%)
Similarity:303/630 - (48%) Gaps:166/630 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   285 IAENVVGMSNASV------------------ALTVY-----------YPP-------RVVSLEEP 313
            :|.|...:.|.|:                  ..|:|           |||       :.:..||.
  Fly   120 VATNAKQLKNVSIRRKRTKSKDIKNISIFKKKSTIYEDVFSTDISSKYPPTRESENLKRICREEC 184

Human   314 ELRLEHCI---EF-VVRGNPPPTLHWLHNGQPLRESK-IIHVEYYQEGEISEGCLLFNKPTHYNN 373
            || ||:.:   |: :.:.:|...:..:.:.|.|.:.| .:.:....|.:.:|.|       ::.:
  Fly   185 EL-LENELCQKEYAIAKRHPVIGMVGVEDCQKLPQHKDCLSLGITIEVDKTENC-------YWED 241

Human   374 GN-YTLIAKNPLGTANQTINGH-------FLKE--PFPE-----------STDNF-ILFDEVSPT 416
            |: |.       |.||.:.:|.       .:||  .|||           |.:|. ..|.:.|..
  Fly   242 GSTYR-------GVANVSASGKPCLRWSWLMKEISDFPELIGQNYCRNPGSVENSPWCFVDSSRE 299

Human   417 PPITVTHKPE-EDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRS--KFGMKGPVAVISGEEDSA 478
            ..|.:...|: .|...::| ||..|...::.:::|.:| .:.||:  .:||:.            
  Fly   300 RIIELCDIPKCADKIWIAI-VGTTAAIILIFIIIFAII-LFKRRTIMHYGMRN------------ 350

Human   479 SPLHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPD--------------TY 529
              :|:||    |||:     |..:.|.::   :.|.|...:|:..:..|              ..
  Fly   351 --IHNIN----TPSA-----DKNIYGNSQ---LNNAQDAGRGNLGNLSDHVALNSKLIERNTLLR 401

Human   530 VQHIKRRDIVLKRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKD-PTLAARKDFQREAELLT 593
            :.|...:|:....||||||||||:..:.  |.|.|..:.||:||||: .::..::||:||.||::
  Fly   402 INHFTLQDVEFLEELGEGAFGKVYKGQL--LQPNKTTITVAIKALKENASVKTQQDFKREIELIS 464

Human   594 NLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQM-- 656
            :|:|::||...||..:.:|..|:||||.:|||::|          |:...|.:.|   .|||:  
  Fly   465 DLKHQNIVCILGVVLNKEPYCMLFEYMANGDLHEF----------LISNSPTEGK---SLSQLEF 516

Human   657 LHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYREGPCQKGPFS 721
            |.||.||:.||.||::.|:||||||.|||||...|:|||.|||:|||:||:||||          
  Fly   517 LQIALQISEGMQYLSAHHYVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSDYYR---------- 571

Human   722 VVWQRQRLAATAASTVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLS 786
                           |...::||:||||.|||:|.|||||||||||||:||||::||.||::..|
  Fly   572 ---------------VQSKSLLPVRWMPSESILYGKFTTESDVWSFGVVLWEIYSYGMQPYYGFS 621

Human   787 NTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEI 831
            |.|||..|...::|..|..||..||.:|:.||..:..:|....:|
  Fly   622 NQEVINLIRSRQLLSAPENCPTAVYSLMIECWHEQSVKRPTFTDI 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NTRK3XP_016877743.1 LRR_8 103..160 CDD:290566
leucine-rich repeat 105..128 CDD:275378
leucine-rich repeat 129..151 CDD:275378
leucine-rich repeat 152..164 CDD:275378
TPKR_C2 163..208 CDD:293525
Ig_TrkABC_d4 211..301 CDD:143173 4/33 (12%)
IG_like 218..301 CDD:214653 4/33 (12%)
Ig_TrKABC_d5 319..396 CDD:143172 14/89 (16%)
PTKc_TrkC 532..843 CDD:270676 135/303 (45%)
TyrKc 538..835 CDD:197581 133/297 (45%)
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568 20/108 (19%)
KR 235..312 CDD:214527 19/90 (21%)
PTKc_Ror 404..673 CDD:270642 135/303 (45%)
Pkinase_Tyr 410..670 CDD:285015 133/297 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.