DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NTRK3 and ark-1

DIOPT Version :9

Sequence 1:XP_016877743.1 Gene:NTRK3 / 4916 HGNCID:8033 Length:850 Species:Homo sapiens
Sequence 2:NP_001255654.1 Gene:ark-1 / 178218 WormBaseID:WBGene00000186 Length:1043 Species:Caenorhabditis elegans


Alignment Length:312 Identity:114/312 - (36%)
Similarity:164/312 - (52%) Gaps:50/312 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   527 DTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSPTKDKMLVAVKAL-KDPTLAARKDFQREAE 590
            |.:|..|::  |.|.:|||:|.||.|:.|...| |...|.:.||||.: .|..||....|.:||.
 Worm   104 DHHVIPIEK--ITLCKELGQGEFGSVWQAGWKN-SAGSDVIQVAVKCVGSDKLLATSSSFLQEAA 165

Human   591 LLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQ 655
            ::|.::|||:|:.|||..|...:::|.|....|.|.:.|  |.|   .|.|..|           
 Worm   166 IMTRMRHEHVVRLYGVVLDTKKIMLVSELATCGSLLECL--HKP---ALRDSFP----------- 214

Human   656 MLHI----ASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDV-YSTDYYREGPC 715
             :|:    |.|||.||.||..|..:|||||.||.||.:..||||.|||:||.: ...||||    
 Worm   215 -VHVLCDYAEQIAMGMSYLELQRLIHRDLAARNVLVFSPKLVKISDFGLSRSLGIGEDYYR---- 274

Human   716 QKGPFSVVWQRQRLAATAASTVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQ 780
                               |....:..|||.|..||.|.:.|||::||||::||.:||:|:||:.
 Worm   275 -------------------SEFTPNLKLPIAWCAPECINFLKFTSKSDVWAYGVTIWEMFSYGEM 320

Human   781 PWFQLSNTEVIECITQGR-VLERPRVCPKEVYDVMLGCWQREPQQRLNIKEI 831
            ||...|..:::|.:.:.: :|.||:.||:::||::...|..:.|.|....:|
 Worm   321 PWKGRSGAQILELVDRKKELLTRPKACPEDIYDMLKETWTHQVQDRPTFSDI 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NTRK3XP_016877743.1 LRR_8 103..160 CDD:290566
leucine-rich repeat 105..128 CDD:275378
leucine-rich repeat 129..151 CDD:275378
leucine-rich repeat 152..164 CDD:275378
TPKR_C2 163..208 CDD:293525
Ig_TrkABC_d4 211..301 CDD:143173
IG_like 218..301 CDD:214653
Ig_TrKABC_d5 319..396 CDD:143172
PTKc_TrkC 532..843 CDD:270676 112/307 (36%)
TyrKc 538..835 CDD:197581 111/301 (37%)
ark-1NP_001255654.1 SAM_superfamily 14..71 CDD:301707
TyrKc 113..376 CDD:197581 111/301 (37%)
PTKc_Ack_like 117..378 CDD:270636 109/297 (37%)
SH3 384..434 CDD:214620
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.