DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Prss36

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:283 Identity:85/283 - (30%)
Similarity:132/283 - (46%) Gaps:43/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLSVLACALAGTIPDGLL--------------PQLDGRIVGGYETSIDAHPYQVSLQRYGSHFC 56
            |::.|::....|...|.::              |:...|||||.:......|:||||.:.|.|.|
Mouse     9 VVIMVVSPIPPGAFQDSVVSPTQGEFEDLDCGRPEPSSRIVGGSDAHPGTWPWQVSLHQGGGHIC 73

  Fly    57 GGSIYSHDIVITAAHCL---QSIE-AKDLKIRVG---STYWRSGGSVHSVRSFRNHEGYNSRTMV 114
            |||:.:...|::||||.   .::| |.:|.:.:|   ......|..:.||.:....:.|::..:.
Mouse    74 GGSLIAPSWVLSAAHCFVTNGTLEPADELSVLLGVHSQDGPLEGAHMRSVATILIPDNYSTVELG 138

  Fly   115 NDIAIIRIESDLSFRSSIREIRIADSNPR------EGATAVVSGWG-TTESGGSTIPDHLLAVDL 172
            .|:|::|:.|......|:|.:.:    ||      .|.....:||| ..|:....:|..|..|:|
Mouse   139 ADLALLRLASPAKLGPSVRPVCL----PRASHLFAHGTACWATGWGDVQEAVPLPLPWVLQEVEL 199

  Fly   173 EIIDVSRC-----RSDEFGYGKKIKDTMLCAYAP--HKDACQGDSGGPLVSGDR----LVGVVSW 226
            .::..:.|     |...|....::...||||..|  .:|.||||||||||..|.    |.|:.|:
Mouse   200 RLLGEAACQCLYSRPGPFNLTFQLLPGMLCAGYPAGRRDTCQGDSGGPLVCEDGGRWFLAGITSF 264

  Fly   227 GYGCGDVRYPGVYADVAHFHEWI 249
            |:|||....|||:..||.:..||
Mouse   265 GFGCGRRNRPGVFTAVAPYESWI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 78/243 (32%)
Tryp_SPc 31..252 CDD:238113 79/244 (32%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 79/244 (32%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.