DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Prss41

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:268 Identity:86/268 - (32%)
Similarity:128/268 - (47%) Gaps:52/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQS-IEAKDL 81
            ::|.|.......|||||.|:.....|:|.||:...||.||||:.|...|:|||||.:. ::.:..
Mouse    71 SMPCGRRNDTRSRIVGGIESMQGRWPWQASLRLKKSHRCGGSLLSRRWVLTAAHCFRKYLDPEKW 135

  Fly    82 KIRVGS-----TYWRSGGSVHSVRSFRNHEGYNSRTMVNDI-------------AIIRIESDLSF 128
            .:::|.     :||             |.:.|:.|..|.||             |::|:.|.:::
Mouse   136 TVQLGQLTSKPSYW-------------NRKAYSGRYRVKDIIVNSEDKLKSHDLALLRLASSVTY 187

  Fly   129 RSSIREIRIADS------NPREGATAVVSGWGTTESGGSTIPD--HLLAVDLEIIDVSRCRS--D 183
            ...|:.:.:..|      .||    ..|:|||..:.....:|.  ||..|.:.|::.|||:.  :
Mouse   188 NKDIQPVCVQPSTFTSQHQPR----CWVTGWGVLQEDLKPLPPPYHLREVQVSILNNSRCQELFE 248

  Fly   184 EFGYGKKIKDTMLCAYAP--HKDACQGDSGGPLVSG-DRL---VGVVSWGYGCGDVRYPGVYADV 242
            .|.....|...:.||.|.  ..|.|.||||||||.. |.|   :|:||||.|||....||:|.:|
Mouse   249 IFSLHHLITKDVFCAGAEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSWGIGCGRPNLPGIYTNV 313

  Fly   243 AHFHEWIE 250
            :|::.|||
Mouse   314 SHYYNWIE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 81/253 (32%)
Tryp_SPc 31..252 CDD:238113 83/255 (33%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.