DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Prss41

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:297 Identity:89/297 - (29%)
Similarity:141/297 - (47%) Gaps:65/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLSVLACALAG---------------------TIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQ 49
            :||.::.|.:.|                     ::|.|....:..|||||.|:.....|:|.||:
  Rat     9 LLLLLVVCVMLGEPGSREENQAAGLKNTDIKLLSMPCGRRNDIRSRIVGGIESVRGRWPWQASLR 73

  Fly    50 RYGSHFCGGSIYSHDIVITAAHCLQS-IEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTM 113
            ....|.||||:.||..|:|||||.:. ::.|...:::        |.:.|..||.|.|.::.|..
  Rat    74 LRKFHRCGGSLLSHRWVLTAAHCFRKFLDPKKWTVQL--------GQLTSKPSFWNREAFSGRYR 130

  Fly   114 VNDI-------------AIIRIESDLSFRSSIREIRIADS------NPREGATAVVSGWGTTESG 159
            |.||             |::|:.|.:::...|:.:.:..|      .||    ..|:|||..:..
  Rat   131 VKDIIINSEDKLKYHDLALLRLASSVTYNKFIQPVCVLPSASMSQHQPR----CWVTGWGALQED 191

  Fly   160 GSTIPD--HLLAVDLEIIDVSRCRSDEFGYGKK---IKDTMLCAYAP--HKDACQGDSGGPLVSG 217
            ...:|.  ||..|.:.::::|||: :.|.:..:   |...:.||.|.  ..|.|.||||||||..
  Rat   192 LKPLPPPYHLREVQVTVLNLSRCQ-ELFSFASRYHLITRDVFCAGAEDGSADTCSGDSGGPLVCN 255

  Fly   218 -DRL---VGVVSWGYGCGDVRYPGVYADVAHFHEWIE 250
             |.|   :|:||.|.|||..:.||:|.:|:|.::||:
  Rat   256 MDGLWYQIGIVSRGVGCGRPKLPGIYTNVSHHYDWIK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 81/249 (33%)
Tryp_SPc 31..252 CDD:238113 82/251 (33%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 81/249 (33%)
Tryp_SPc 55..292 CDD:238113 81/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.