DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and prss1

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:265 Identity:98/265 - (36%)
Similarity:142/265 - (53%) Gaps:36/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIV 66
            :|..:||::.|.|.|..:.|.     |.:||||||.:.:..||||||.. |.||||||:.|:..|
Zfish     1 MKAFILLALFAVAYAAPLGDD-----DDKIVGGYECTKNGVPYQVSLNS-GYHFCGGSLISNLWV 59

  Fly    67 ITAAHCLQSIEAKDLKIRVGSTYWRSGGSVHSV------RSFRN------HEGYNSRTMVNDIAI 119
            ::||||.:|    .:::|:|.         |::      ..|.|      |..|||.|:.||:.:
Zfish    60 VSAAHCYKS----RVQVRLGE---------HNIDVTEGTEQFINSEKVIRHPSYNSNTLDNDVML 111

  Fly   120 IRIESDLSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDE 184
            |::.|.....|.::.:.:..|....|.:.::||||...:.||..|..|:.::..|:..|.||:  
Zfish   112 IKLSSSAQINSYVKTVSLPSSCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILSDSTCRN-- 174

  Fly   185 FGYGKKIKDTMLCA--YAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHE 247
             .|..:|...|.||  ....||:||||||||:|..::|.|:|||||||.....|||||.|.:|..
Zfish   175 -AYPGQISSNMFCAGFMEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNKPGVYAKVCNFTT 238

  Fly   248 WIERT 252
            ||..|
Zfish   239 WIRNT 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 87/232 (38%)
Tryp_SPc 31..252 CDD:238113 89/234 (38%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 87/232 (38%)
Tryp_SPc 25..243 CDD:238113 89/234 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.