DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and zgc:123295

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:271 Identity:100/271 - (36%)
Similarity:151/271 - (55%) Gaps:30/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFAVLLSVLACAL---AGTIPD----GLLPQLDGRIVGGYETSIDAHPYQVSLQ--RYGSHFCG 57
            :|....|:|:...|   ||::..    |..| |:.:||||......:.|:|||||  .||.||||
Zfish     1 MKINTALTVVGALLVNIAGSLCQLNVCGRAP-LNTKIVGGQNAGAGSWPWQVSLQSPTYGGHFCG 64

  Fly    58 GSIYSHDIVITAAHCLQ-SIEAKDLKIRVGSTYWRSGGSVH----SVRSFRNHEGYNSRTMVNDI 117
            ||:.:.|.|::||||.| ||....:|:.:.|   :||.:.:    :|....||..||:.:..|||
Zfish    65 GSLINKDWVLSAAHCFQDSIGTIMVKLGLQS---QSGSNPYQITKTVVQVINHPNYNNPSNDNDI 126

  Fly   118 AIIRIESDLSFRSSIREIRI--ADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRC 180
            |:::::|.::|...|..:.:  |.:....|..:.|:|||...|..:.|||.|..|::.|:..|.|
Zfish   127 ALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPIVSHSDC 191

  Fly   181 RSDEFGYGKKIKDTMLCA---YAPHKDACQGDSGGPLVS--GDRLV--GVVSWGYGCGDVRYPGV 238
            :.   .|..:|...|:||   ....||:||||||||:||  |.:.:  |:||:|.||.:..||||
Zfish   192 KR---AYPGEITSNMICAGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPGV 253

  Fly   239 YADVAHFHEWI 249
            ||.|:.:.:||
Zfish   254 YARVSQYQDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 89/234 (38%)
Tryp_SPc 31..252 CDD:238113 91/235 (39%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 89/234 (38%)
Tryp_SPc 36..264 CDD:238113 89/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.