DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG17242

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:258 Identity:88/258 - (34%)
Similarity:128/258 - (49%) Gaps:25/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDI 65
            ||...:||.|....:|.          |.:.:|     |:..|:|.|:|....|.|||.|||.||
  Fly     1 MLLKGILLLVSIAQIAA----------DFKSIG-----IEQAPWQASVQINDKHHCGGVIYSEDI 50

  Fly    66 VITAAHCLQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHE-GYNSRTMVNDIAIIRIESDLSFR 129
            ::|.|.|::....:.:.:||||....:||:|..|...|... |...    :|:||:::.|.|...
  Fly    51 ILTIAECVRKARLEFISVRVGSAQENAGGTVLKVEKMRLQVLGLRP----SDVAILQLRSPLYLD 111

  Fly   130 SSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDT 194
            ..||.|.:|......|..|.|||||.. |..:...:.||.||::|.|...|.::....|:.:...
  Fly   112 GGIRAIPLATIPLVPGTNASVSGWGQL-SAMNPSSEVLLRVDVKIQDQLMCATNLALKGRLMSVG 175

  Fly   195 MLCAYAPHKD---ACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIERTAE 254
            .:|| ||..:   ||||..|||||:.:||.|::||...|..:....|||::|.|..|||.|.:
  Fly   176 EICA-APAGEIPYACQGFVGGPLVANNRLYGILSWQSACDVLNKSSVYANIAMFKVWIESTVK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 77/222 (35%)
Tryp_SPc 31..252 CDD:238113 80/224 (36%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 79/216 (37%)
Tryp_SPc 24..232 CDD:214473 76/213 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.