DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG34458

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:253 Identity:83/253 - (32%)
Similarity:130/253 - (51%) Gaps:10/253 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAA 70
            |.||:|..|:.....|..:.: :.||:||...:....|:|||||..|.|.||||:.|..:::|||
  Fly     8 VKLSILLLAVTFVHSDMDVAE-ESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAA 71

  Fly    71 HCLQSIEAKDLKIRVGSTYWRSG-GSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIRE 134
            ||........:|..||:....:| |...::..|..|..||.::...|:::|::.|.:....:::.
  Fly    72 HCTMGQNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQT 136

  Fly   135 IRIADSNPREGA--TAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLC 197
            |::|||:....|  .|::||:|.... ...:|:.|....:::.....|.|...   ..:.|.|:|
  Fly   137 IQLADSDSNYAADTMAMISGFGAINQ-NLQLPNRLKFAQVQLWSRDYCNSQNI---PGLTDRMVC 197

  Fly   198 AYAP--HKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIERTA 253
            |..|  ...:|||||||||....:|.||||||:|||....|.:|..|.....||::.|
  Fly   198 AGHPSGQVSSCQGDSGGPLTVDGKLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQNA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 74/223 (33%)
Tryp_SPc 31..252 CDD:238113 75/225 (33%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 74/223 (33%)
Tryp_SPc 32..254 CDD:238113 75/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452410
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.