DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and CG34457

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster


Alignment Length:61 Identity:15/61 - (24%)
Similarity:26/61 - (42%) Gaps:6/61 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 IPDHLLAVDLEIIDVSRCRSDEFG-----YGKKIKDTMLCAYAPHKDACQGDSGGPLVSGD 218
            :|.|:...|::..|::...|....     ..:.|.:....:.||.|..|..:| ..:||||
  Fly    81 MPIHINISDMDTTDLNAALSVVINEKVVRKSQSINEDCELSVAPSKRPCVRNS-FKIVSGD 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 15/61 (25%)
Tryp_SPc 31..252 CDD:238113 15/61 (25%)
CG34457NP_001097339.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.