DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and AZU1

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:260 Identity:77/260 - (29%)
Similarity:117/260 - (45%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITA 69
            |:|..:||.:.||:     .|.||  ||||.:......|:..|:|..|.|||||::.....|:||
Human     8 ALLAGLLASSRAGS-----SPLLD--IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTA 65

  Fly    70 AHCLQS---------IEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESD 125
            |.|.||         :.|.||:.|.     |......|:.|. :..||:.:..:||:.:::::.:
Human    66 ASCFQSQNPGVSTVVLGAYDLRRRE-----RQSRQTFSISSM-SENGYDPQQNLNDLMLLQLDRE 124

  Fly   126 LSFRSS--IREIRIADSNPREGATAVVSGWGTTESGG--STIPDHLLAVDLEIIDVSRCRSDEFG 186
            .:..||  |..:.:.::....|....|:|||:..|||  |..|..   |::.:....:||.:...
Human   125 ANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRF---VNVTVTPEDQCRPNNVC 186

  Fly   187 YGKKIKDTMLCAYAPHKDACQGDSGGPLVSGDRLVGVVSWGYG-CGDVRYPGVYADVAHFHEWIE 250
            .|         ........|.||.|.|||......||.|:..| ||  |.|..:..||.|.:||:
Human   187 TG---------VLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCG--RGPDFFTRVALFRDWID 240

  Fly   251  250
            Human   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 66/232 (28%)
Tryp_SPc 31..252 CDD:238113 68/234 (29%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 67/232 (29%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 11/23 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.