DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and PRTN3

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:276 Identity:76/276 - (27%)
Similarity:122/276 - (44%) Gaps:61/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQ---RYGSHFCGGSIYSHDIV 66
            :|||::|....|..          ..||||:|....:.||..|||   ..|||||||::.....|
Human    12 SVLLALLLSGAARA----------AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFV 66

  Fly    67 ITAAHCLQSIEAKDLKIRVGSTYWRSGGSVHSVRS-------------FRNHEGYNSRTMVNDIA 118
            :||||||:.|..:.:.:.:|:         |:||:             |.|:  |::...:||:.
Human    67 LTAAHCLRDIPQRLVNVVLGA---------HNVRTQEPTQQHFSVAQVFLNN--YDAENKLNDVL 120

  Fly   119 IIRIESDLSFRSSIREIRI--ADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVS-RC 180
            :|::.|..:..:|:..:::  .|.....|...:..|||..   |:..|...:..:|.:..|: .|
Human   121 LIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRV---GAHDPPAQVLQELNVTVVTFFC 182

  Fly   181 RSDEFGYGKKIKDTMLCAYAPHKDA--CQGDSGGPLVSGDRLVGV---VSWGYGCGDVRYPGVYA 240
            |...           :|.:.|.:.|  |.|||||||:....:.|:   |.|  ||....:|..:.
Human   183 RPHN-----------ICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIW--GCATRLFPDFFT 234

  Fly   241 DVAHFHEWIERTAEEV 256
            .||.:.:||..|...|
Human   235 RVALYVDWIRSTLRRV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 67/242 (28%)
Tryp_SPc 31..252 CDD:238113 69/244 (28%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 69/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.