DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and PRSS2

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:275 Identity:98/275 - (35%)
Similarity:140/275 - (50%) Gaps:43/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIV 66
            :...::|:.:|.|:|....|      |.:|||||....::.||||||.. |.||||||:.|...|
Human     1 MNLLLILTFVAAAVAAPFDD------DDKIVGGYICEENSVPYQVSLNS-GYHFCGGSLISEQWV 58

  Fly    67 ITAAHCLQS----------IEAKDLKIRVGSTYWRSGGSVHSV------RSFRN------HEGYN 109
            ::|.||.:|          .|...:::|:|.         |::      ..|.|      |..||
Human    59 VSAGHCYKSAINSKLSGRGCEYHRIQVRLGE---------HNIEVLEGNEQFINAAKIIRHPKYN 114

  Fly   110 SRTMVNDIAIIRIESDLSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEI 174
            |||:.|||.:|::.|.....|.:..|.:..:.|..|..:::||||.|.|.|:..||.|..:|..:
Human   115 SRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPV 179

  Fly   175 IDVSRCRSDEFGYGKKIKDTMLCA--YAPHKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPG 237
            :..:.|   |..|..||.:.|.|.  ....||:||||||||:||...|.|:|||||||.....||
Human   180 LSQAEC---EASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPG 241

  Fly   238 VYADVAHFHEWIERT 252
            ||..|.::.:||:.|
Human   242 VYTKVYNYVDWIKDT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 89/242 (37%)
Tryp_SPc 31..252 CDD:238113 91/244 (37%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 89/242 (37%)
Tryp_SPc 24..256 CDD:238113 91/244 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.