DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:268 Identity:98/268 - (36%)
Similarity:138/268 - (51%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQ-RYGSHFCGGSIYSHD 64
            :|...|||.:||.:....|        ..||||||..:..:..|.||:| ..|.|||||::.:..
Zfish     5 LLLLCVLLEILAVSCQDVI--------QARIVGGYVPAPYSIKYIVSIQSATGQHFCGGTLINKY 61

  Fly    65 IVITAAHCLQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRN------HEGYNSRTMVNDIAIIRIE 123
            .|:|||||  :|...:::|..|.   .|.|....:..||.      |..|:..|...||.:|:::
Zfish    62 WVLTAAHC--NIGEANMRIVAGD---YSVGLYEGMEQFRRPHMLIPHPQYDRSTNNADIMLIKLQ 121

  Fly   124 SDLSFRSSIREIRIADSNPRE------GATAVVSGWG-TTESGGSTIPDHLLAVDLEIIDVSRCR 181
            |.:...|.:..:.:    ||:      |....||||| ||.:||  |...|..|.|.|:..:.|.
Zfish   122 SPVYLNSYVSLVPL----PRQDAMVAVGRLCSVSGWGFTTSTGG--ISSILRTVKLPIVSTAVCN 180

  Fly   182 SDEFGYGKKIKDTMLCA-YAP-HKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAH 244
            ..: .:...|.:.|:|| |:. .||||:||||||||...|:.|:||||.||.|.:|||||..|:.
Zfish   181 GTD-SFNGNITENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWGNGCADAQYPGVYTAVSQ 244

  Fly   245 FHEWIERT 252
            |.:||:.|
Zfish   245 FRQWIDAT 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 88/234 (38%)
Tryp_SPc 31..252 CDD:238113 89/236 (38%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 88/234 (38%)
Tryp_SPc 27..252 CDD:238113 89/236 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.