DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and KLK15

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:263 Identity:85/263 - (32%)
Similarity:130/263 - (49%) Gaps:30/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSVLACALAGTIPDGLLPQLDG-RIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAA 70
            ||..|:..||.|...      || :::.|.|.:..:.|:||:|...|...||.|:.|...|::||
Human     3 LLLTLSFLLASTAAQ------DGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAA 61

  Fly    71 HCLQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRN---HEGYNSRTMVNDIAIIRIESDLSFRSSI 132
            ||    :::.:::|:|....|.......:|:...   |..|.:|:..|||.::|:.........:
Human    62 HC----QSRFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQV 122

  Fly   133 REIRIADSNPREGATAVVSGWGTTE-----SGGS-----TIPDHLLAVDLEIIDVSRCRSDEFGY 187
            |...:....|..|...||||||...     :.||     ::||.|...::.||..:.|   :..|
Human   123 RPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSC---DKSY 184

  Fly   188 GKKIKDTMLCAYAPHK--DACQGDSGGPLVSGDRLVGVVSWG-YGCGDVRYPGVYADVAHFHEWI 249
            ..::.:||:||.|..:  ::|:||||||||.|..|.|:|||| ..|.:...||||..|.|:.|||
Human   185 PGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWI 249

  Fly   250 ERT 252
            ..|
Human   250 RET 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 74/234 (32%)
Tryp_SPc 31..252 CDD:238113 76/236 (32%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 74/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.