DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and zgc:112038

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:254 Identity:89/254 - (35%)
Similarity:135/254 - (53%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLLPQLD--GRIV-----GGYETSIDAHPYQVSLQRYG--SHFCGGSIYSHDIVITAAHCLQSIE 77
            |.|.|||  |:..     ||.:....:.|:|.|:.|..  .|.||||:.:.|.|::||||.....
Zfish    19 GALCQLDVCGQAPLNNNNGGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCFMITA 83

  Fly    78 AKDLKIRVGSTYWRSGGSVHSV-RSFRN---HEGYNSRTMVNDIAIIRIESDLSFRSSIREIRI- 137
            ..::||.:|..: ::|.:.:.: |:...   |..|::.|..||||::|:.|.::|...||.:.: 
Zfish    84 TANIKIFLGRQF-QTGSNPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCLA 147

  Fly   138 -ADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCAYAP 201
             |||....|..:.::||....|....:.:.|..|.|.::..:.|.:|   |...|.|.|:||...
Zfish   148 SADSVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNAD---YKGIITDNMICAGIN 209

  Fly   202 H--KDACQGDSGGPLVS--GDRLV--GVVSWGYGCGDVRYPGVYADVAHFHEWIERTAE 254
            .  |||||||||||:||  |.|.:  |:||:|..||..||||:|..|:.:..||  |:|
Zfish   210 EGGKDACQGDSGGPMVSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWI--TSE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 79/237 (33%)
Tryp_SPc 31..252 CDD:238113 81/239 (34%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 79/229 (34%)
Tryp_SPc 37..263 CDD:238113 79/229 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.