DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Tpsab1

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:272 Identity:86/272 - (31%)
Similarity:130/272 - (47%) Gaps:26/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQ---RYGSHFCGGSIYS 62
            |||..:|...|..:|....|...:|: :| ||||.|.|.:..|:||||:   .|..||||||:..
  Rat    38 MLKLLLLTLPLLSSLVHAAPSLAMPR-EG-IVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIH 100

  Fly    63 HDIVITAAHCL--QSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESD 125
            ...|:|||||:  ...:...|::::...|......:.:|....:|..:.......|||::::.:.
  Rat   101 PQWVLTAAHCVGPNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNP 165

  Fly   126 LSFRSSIREIRI--ADSNPREGATAVVSGWGTTESGGSTIPDH-LLAVDLEIIDVSRCRSDEFGY 187
            ::..|::..:.:  |......|....|:|||...:..|..|.. |..|.:.|::...|   :..|
  Rat   166 VNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLC---DLKY 227

  Fly   188 GKK---------IKDTMLCAYAPHKDACQGDSGGPLVSGDR----LVGVVSWGYGCGDVRYPGVY 239
            .|.         ::|.||||.....|:||||||||||....    ..||||||.||.....||:|
  Rat   228 HKGLNTGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIY 292

  Fly   240 ADVAHFHEWIER 251
            ..|.::.:||.|
  Rat   293 TRVTYYLDWIYR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 74/239 (31%)
Tryp_SPc 31..252 CDD:238113 77/242 (32%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 74/238 (31%)
Tryp_SPc 66..302 CDD:238113 74/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.