DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and Prss36

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:258 Identity:80/258 - (31%)
Similarity:119/258 - (46%) Gaps:45/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHC---------------LQ 74
            |:...|||||.:......|:||||...|.|.||||:.:...|::||||               |.
  Rat    53 PEPSSRIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEWSVLL 117

  Fly    75 SIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIAD 139
            .:.::|..:        .|..:.||.:....:.|:...:..|:|::|:.|......|::.:.:  
  Rat   118 GVHSQDGPL--------EGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGPSVKPVCL-- 172

  Fly   140 SNPR------EGATAVVSGWG-TTESGGSTIPDHLLAVDLEIIDVSRC-----RSDEFGYGKKIK 192
              ||      .|.....:||| ..||....:|..|..|:|:::..:.|     |...|....::.
  Rat   173 --PRASHLFAHGTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLL 235

  Fly   193 DTMLCAYAP--HKDACQGDSGGPLVSGDR----LVGVVSWGYGCGDVRYPGVYADVAHFHEWI 249
            ..||||..|  .:|.||||||||||..|.    |.|:.|:|:|||....|||:..|||:..||
  Rat   236 PGMLCAGYPEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAHYESWI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 77/251 (31%)
Tryp_SPc 31..252 CDD:238113 78/252 (31%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 78/252 (31%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.