DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment epsilonTry and try10

DIOPT Version :9

Sequence 1:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001011209.1 Gene:try10 / 496640 XenbaseID:XB-GENE-6453489 Length:243 Species:Xenopus tropicalis


Alignment Length:256 Identity:98/256 - (38%)
Similarity:137/256 - (53%) Gaps:22/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFAVLLSVLACALAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIV 66
            :|..:|.|:|..|:|..|.|      |.:|||||..|:   ||||||.. |.||||||:.:...|
 Frog     1 MKTLLLFSLLGLAVAQPIED------DDKIVGGYHCSV---PYQVSLNA-GYHFCGGSLINEHWV 55

  Fly    67 ITAAHCLQSIEAKDLKIRVG-STYWRSGGSVHSVRSFR--NHEGYNSRTMVNDIAIIRIESDLSF 128
            ::||||.||    .:::|:| :......|:...::|.:  .|..|||.|:.|||.:|:::.....
 Frog    56 VSAAHCYQS----KMELRIGENNIELLEGTEQFIQSAKIIRHPQYNSWTIDNDIMLIQLQEPAQL 116

  Fly   129 RSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKD 193
            .:.::.|.:....|..|:..::||||.|.|.|...||.|..::..|:....||.   .|...|.|
 Frog   117 NNEVQPIPLPTECPPVGSICLISGWGNTLSNGVNYPDLLQCIEAPILSDQECRQ---SYPGSITD 178

  Fly   194 TMLC-AYAPHK-DACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIERT 252
            .|:| .|.... |:||||||||:|....|.||||||.||....|||||..|.::..||..|
 Frog   179 NMICVGYLEGGIDSCQGDSGGPVVCDGELQGVVSWGRGCALPGYPGVYTKVCNYLSWIRDT 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 86/223 (39%)
Tryp_SPc 31..252 CDD:238113 88/225 (39%)
try10NP_001011209.1 Tryp_SPc 24..239 CDD:238113 88/225 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.